YALI0C03069g


similar to uniprot|P23202 Saccharomyces cerevisiae YNL229c URE2 nitrogen catabolite repression regulator

Genomic environment map

Element type: CDS
Element length: 1002 nucleotides,
on anti-sense strand of
Yali0C: complement(413937..414938).
Other names:
YALI-CDS3979.1
YALI-IPF6841
Coding sequence: 334 codons.
Database cross references:
EMBL: CR382129
GeneID: 2909060
GenomeReviews: CR382129_GR
HOGENOM: HBG753188

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0580
Orthologs: strict determination not possible; homologs must be refined manually

Protein YALI0C03069p  


similar to uniprot|P23202 Saccharomyces cerevisiae YNL229c URE2 nitrogen catabolite repression regulator; SubName: Full=YALI0C03069p;

Protein domain map

Protein length: 333 amino acids
Protein family: GL3C0580
Database cross references:
Gene3D: G3DSA:1.20.1050.10
Gene3D: G3DSA:3.40.30.10
InterPro: IPR004045
InterPro: IPR004046
InterPro: IPR010987
InterPro: IPR012335
InterPro: IPR012336
InterPro: IPR017298
InterPro: IPR017933
KEGG: yli:YALI0C03069g
PIRSF: PIRSF037861
PROSITE: PS50404
PROSITE: PS50405
Pfam: PF00043
Pfam: PF02798
RefSeq: XP_501385.1
SMR: Q6CD77
UniProtKB/TrEMBL: Q6CD77
UniProtKB: Q6CD77_YARLI

Phylogeny  

PhylomeDB:YALI0C03069g

Computed results for YALI0C03069p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>YALI0C03069g.nt
ATGGACCAGCCCCGCAAACTGTCGAATCTGTCGTCGGCTCTGGCCAGCATCTCTCTACAC
AATGGCGACGATTACGTGCCACAAAACCAACAGCAGCAGCAACAGGCGTACGGAGGCCAG
CCCATGTCCCAGTACCAGCAACAGCAGCATCAGCAGCAGCAGCAGGATGACGACATCAGC
ATGAGCGTGTCTGCCCCGCGGCATGCTATCCCGCAGATGCAGCAAATCCCCATGGAGGAA
CTGGACAAAATCGCACAGTACAAGCTCAACTACCCGGACGACGGCATCACGCTTTTCAGC
CATCGGTCAGCACCCAACGGCTTTAAAATCGCTGTGGTTCTGAGCGAGCTGGGCCTCAAG
TACCGCACCGTCTTCCTGGACTTTAAGAAGAATGAGCAGCGATCCCCTGCCTACATTTCG
GTCAATCCCAACGCCCGAGTGCCTTCTATCATTGACCACGACAATGAGCATGTCAGTGTG
TGGGAGTCTGGCGCGATACTTATATATCTGTGCCAGAAGGCCGGCCCAGACTGTCCCTTG
TGGTCCGAAGATGTGATTGAACAGTCACAAATTAACTCGTGGCTCTTCTTCCAAACCTCC
GGCCACGCCCCCATGGTGGGACAGGCCCTGCATTTCCGATACTTCCACCCCGAACTCATT
CCATCGGCAATTGAACGGTACACCAACGAGGTGCGACGTATCTATGGAGTGGTGGAGATG
CGGCTGGCCGAAAAGCGGGAGCAGCTGATTCTGGAGATGGACGACGAGAGCTTTGCCCTG
GGTACGTCGGCATTGTCCGAGTCGAAATACTTTGACGAGCCCGTGTGGCTAGTCGGAAAC
CGCATGACGATTGCCGATCTGGCGTTTGTCACCTGGAATAACGTGGTGGATAGAATCGGA
ATCGATCTCAAGGGAGAGCTACCGGAGGTGTACAAATGGACGAGGTTCATGATGGGCCGT
CCGGCCGTCATTCGGGCACTTAAGGGACAGGATAATGTTTAA

Coding sequence    

>YALI0C03069g.cds
ATGGACCAGCCCCGCAAACTGTCGAATCTGTCGTCGGCTCTGGCCAGCATCTCTCTACAC
AATGGCGACGATTACGTGCCACAAAACCAACAGCAGCAGCAACAGGCGTACGGAGGCCAG
CCCATGTCCCAGTACCAGCAACAGCAGCATCAGCAGCAGCAGCAGGATGACGACATCAGC
ATGAGCGTGTCTGCCCCGCGGCATGCTATCCCGCAGATGCAGCAAATCCCCATGGAGGAA
CTGGACAAAATCGCACAGTACAAGCTCAACTACCCGGACGACGGCATCACGCTTTTCAGC
CATCGGTCAGCACCCAACGGCTTTAAAATCGCTGTGGTTCTGAGCGAGCTGGGCCTCAAG
TACCGCACCGTCTTCCTGGACTTTAAGAAGAATGAGCAGCGATCCCCTGCCTACATTTCG
GTCAATCCCAACGCCCGAGTGCCTTCTATCATTGACCACGACAATGAGCATGTCAGTGTG
TGGGAGTCTGGCGCGATACTTATATATCTGTGCCAGAAGGCCGGCCCAGACTGTCCCTTG
TGGTCCGAAGATGTGATTGAACAGTCACAAATTAACTCGTGGCTCTTCTTCCAAACCTCC
GGCCACGCCCCCATGGTGGGACAGGCCCTGCATTTCCGATACTTCCACCCCGAACTCATT
CCATCGGCAATTGAACGGTACACCAACGAGGTGCGACGTATCTATGGAGTGGTGGAGATG
CGGCTGGCCGAAAAGCGGGAGCAGCTGATTCTGGAGATGGACGACGAGAGCTTTGCCCTG
GGTACGTCGGCATTGTCCGAGTCGAAATACTTTGACGAGCCCGTGTGGCTAGTCGGAAAC
CGCATGACGATTGCCGATCTGGCGTTTGTCACCTGGAATAACGTGGTGGATAGAATCGGA
ATCGATCTCAAGGGAGAGCTACCGGAGGTGTACAAATGGACGAGGTTCATGATGGGCCGT
CCGGCCGTCATTCGGGCACTTAAGGGACAGGATAATGTTTAA

Predicted translation product    

>YALI0C03069g.aa
MDQPRKLSNLSSALASISLHNGDDYVPQNQQQQQQAYGGQPMSQYQQQQHQQQQQDDDIS
MSVSAPRHAIPQMQQIPMEELDKIAQYKLNYPDDGITLFSHRSAPNGFKIAVVLSELGLK
YRTVFLDFKKNEQRSPAYISVNPNARVPSIIDHDNEHVSVWESGAILIYLCQKAGPDCPL
WSEDVIEQSQINSWLFFQTSGHAPMVGQALHFRYFHPELIPSAIERYTNEVRRIYGVVEM
RLAEKREQLILEMDDESFALGTSALSESKYFDEPVWLVGNRMTIADLAFVTWNNVVDRIG
IDLKGELPEVYKWTRFMMGRPAVIRALKGQDNV*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites