SACE0H03212g


YHR079C IRE1, Serine-threonine kinase and endoribonuclease; transmembrane protein that mediates the unfolded protein response (UPR) by regulating Hac1p synthesis through HAC1 mRNA splicing; Kar2p binds inactive Ire1p and releases from it upon ER stress

Genomic environment map

Element type: CDS
Element length: 3348 nucleotides,
on anti-sense strand of
Sace0H: complement(258246..261593).
Other names:
IRE1
YHR079C
Coding sequence: 1116 codons.
Database cross references:
ArrayExpress: P32361
CYGD: YHR079c
EMBL: AAA34489.1
EMBL: AAB68894.1
EMBL: BK006934
EMBL: CAA77763.1
EMBL: L19640
EMBL: U10556
EMBL: Z11701
GeneID: 856478
HOGENOM: HBG203762
NMPDR: fig|4932.3.peg.3106

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3R1375
Orthologs: strict determination not possible; homologs must be refined manually

Protein SACE0H03212p  


Protein domain map

Protein length: 1115 amino acids
Protein family: GL3R1375
Database cross references:
DIP: DIP-233N
Gene3D: G3DSA:2.140.10.10
GermOnline: YHR079C
IntAct: P32361
InterPro: IPR000719
InterPro: IPR002372
InterPro: IPR006567
InterPro: IPR008271
InterPro: IPR010513
InterPro: IPR011009
InterPro: IPR011047
InterPro: IPR017442
InterPro: IPR018391
KEGG: sce:YHR079C
NextBio: 982158
PDB: 2BE1
PDB: 2RIO
PDB: 3FBV
PDB: 3LJ0
PDB: 3LJ1
PDB: 3LJ2
PDB: 3SDJ
PDB: 3SDM
PDBsum: 2BE1
PDBsum: 2RIO
PDBsum: 3FBV
PDBsum: 3LJ0
PDBsum: 3LJ1
PDBsum: 3LJ2
PDBsum: 3SDJ
PDBsum: 3SDM
PIR: A47541
PROSITE: PS00107
PROSITE: PS00108
PROSITE: PS50011
PROSITE: PS51392
Pfam: PF00069
Pfam: PF06479
Reactome: REACT_97252
RefSeq: NP_011946.1
SGD: S000001121
SMART: SM00564
SMART: SM00580
SMR: P32361
UniProtKB/Swiss-Prot: P32361
UniProtKB: IRE1_YEAST

Phylogeny  

PhylomeDB:SACE0H03212g

Computed results for SACE0H03212p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>SACE0H03212g.nt
ATGCGTCTACTTCGAAGAAACATGTTAGTATTGACACTGCTCGTTTGTGTGTTTTCATCC
ATCATTTCATGCTCAATCCCATTGTCGTCTCGCACCTCAAGGCGGCAGATAGTGGAAGAT
GAAGTTGCCTCCACTAAAAAGCTCAATTTCAACTATGGTGTGGATAAAAATATAAACTCG
CCCATTCCTGCTCCAAGAACCACTGAAGGTTTACCAAATATGAAACTCAGCTCATATCCA
ACTCCTAACTTATTGAATACTGCTGATAATCGACGTGCTAACAAAAAAGGACGTAGGGCT
GCCAATTCTATAAGTGTACCCTATTTGGAGAATCGTTCCTTGAACGAACTGAGTTTATCA
GATATACTAATCGCAGCCGACGTTGAGGGTGGACTTCATGCTGTAGATAGAAGAAATGGT
CATATCATATGGTCAATCGAACCAGAAAATTTTCAACCTCTGATAGAAATACAAGAACCT
TCGAGGTTAGAAACATATGAAACGTTGATTATAGAACCTTTCGGTGATGGGAACATTTAC
TACTTTAACGCCCATCAAGGGTTACAAAAACTGCCTTTATCCATACGACAACTTGTATCA
ACTTCCCCGCTGCACTTGAAAACAAATATTGTGGTTAATGACTCTGGAAAAATTGTTGAA
GATGAAAAGGTCTACACTGGATCGATGAGAACTATAATGTATACTATAAACATGTTGAAT
GGTGAAATTATATCAGCGTTCGGACCTGGTTCAAAAAACGGGTATTTCGGGAGCCAGAGT
GTGGATTGCTCACCTGAGGAGAAGATAAAACTTCAGGAATGTGAAAATATGATTGTAATA
GGCAAAACTATTTTTGAGCTGGGAATTCACTCTTATGATGGAGCAAGCTACAATGTCACT
TACTCTACATGGCAGCAAAATGTTTTAGATGTTCCCCTAGCGCTTCAGAATACATTTTCA
AAGGACGGCATGTGCATAGCGCCTTTCCGTGATAAATCATTGCTAGCAAGCGATTTAGAT
TTTAGAATTGCTAGATGGGTTTCTCCGACATTCCCCGGAATTATTGTTGGGCTTTTCGAT
GTGTTTAATGATCTCCGCACCAATGAAAATATACTGGTACCGCATCCCTTTAATCCTGGT
GATCATGAAAGTATATCGAGTAACAAAGTTTACTTGGATCAGACTTCGAACCTCTCCTGG
TTTGCATTATCTAGTCAGAATTTTCCATCTTTAGTCGAATCAGCTCCCATATCAAGATAC
GCTTCCAGTGACCGTTGGAGGGTGTCTTCAATTTTTGAAGATGAGACTTTATTCAAGAAC
GCAATCATGGGTGTTCATCAGATATATAATAATGAATATGATCACCTTTATGAAAACTAT
GAAAAAACGAATAGTTTGGACACTACGCACAAATATCCACCTCTGATGATTGATTCGTCC
GTTGATACAACCGATTTACATCAGAATAACGAGATGAATTCACTAAAGGAATACATGTCA
CCAGAAGACCTTGAGGCATATAGAAAAAAGATACACGAGCAAATATCGAGAGAATTAGAT
GAAAAGAACCAAAATTCTTTGCTACTGAAGTTTGGAAGTCTAGTATATCGAATTATAGAG
ACTGGAGTATTTCTGTTGTTATTTCTCATTTTTTGTGCAATACTACAAAGATTCAAAATT
TTGCCGCCACTATATGTATTATTATCCAAAATTGGATTTATGCCTGAAAAGGAAATCCCC
ATAGTTGAGTCGAAATCGCTAAATTGTCCCTCTTCATCGGAAAATGTAACCAAGCCATTC
GATATGAAATCAGGGAAGCAAGTTGTTTTTGAAGGTGCTGTGAACGATGGAAGTCTAAAA
TCTGAAAAAGATAACGATGATGCTGATGAAGATGATGAAAAATCACTAGATTTAACCACA
GAAAAGAAGAAGAGGAAAAGAGGTTCGAGAGGAGGCAAAAAGGGCCGAAAATCACGCATT
GCAAATATACCAAACTTTGAGCAATCTTTAAAAAATTTGGTAGTATCCGAAAAAATTTTA
GGTTACGGTTCATCAGGAACAGTAGTTTTTCAGGGAAGTTTTCAAGGAAGACCTGTTGCG
GTAAAGAGAATGTTAATTGATTTTTGTGACATAGCTTTAATGGAAATAAAACTTTTGACT
GAAAGCGATGATCACCCTAACGTCATACGATACTACTGTTCAGAAACAACAGACAGATTT
TTGTATATTGCTTTAGAGCTCTGCAATTTGAACCTTCAAGATTTGGTGGAGTCTAAGAAT
GTATCAGATGAAAACCTGAAATTACAGAAAGAGTATAATCCAATTTCGTTATTGAGACAA
ATAGCGTCCGGGGTAGCACATTTACATTCTTTAAAGATTATCCATCGAGATTTAAAGCCT
CAAAATATTCTCGTTTCTACTTCGAGTAGGTTTACTGCCGATCAGCAAACAGGAGCAGAA
AATCTTCGAATTTTGATATCAGACTTTGGTCTTTGCAAAAAACTAGACTCTGGTCAGTCT
TCATTTAGAACAAATTTGAATAACCCTTCTGGCACAAGTGGTTGGAGGGCCCCAGAGCTG
CTTGAAGAATCAAACAATTTGCAGTGCCAAGTCGAAACGGAACACTCTTCTAGTAGGCAT
ACAGTAGTTTCATCTGATTCTTTTTATGATCCGTTCACCAAGAGGAGGCTAACAAGATCT
ATTGATATTTTTTCTATGGGATGTGTATTCTATTATATCCTATCCAAAGGGAAGCATCCA
TTTGGAGATAAATATTCACGTGAAAGCAATATCATAAGAGGAATATTCAGTCTTGATGAA
ATGAAATGTCTACATGATAGATCCTTAATTGCAGAAGCTACAGATCTGATCTCCCAAATG
ATTGATCACGATCCGTTAAAAAGACCTACTGCTATGAAAGTTCTAAGGCATCCGTTGTTT
TGGCCAAAGTCGAAAAAATTGGAGTTCCTTTTAAAAGTTAGTGATAGGCTTGAAATTGAA
AACAGAGACCCTCCAAGTGCCCTGTTAATGAAATTTGACGCCGGTTCTGACTTTGTAATA
CCCAGTGGAGATTGGACTGTCAAGTTTGATAAAACATTCATGGACAACCTTGAAAGGTAC
AGAAAATACCATTCATCAAAGTTAATGGATCTATTAAGAGCACTTAGGAATAAATATCAT
CATTTTATGGATTTACCTGAAGATATAGCAGAACTAATGGGGCCGGTACCCGATGGATTT
TACGATTACTTCACCAAGCGTTTTCCAAACCTATTAATAGGTGTTTATATGATTGTCAAG
GAAAATTTAAGTGACGATCAAATTTTACGTGAATTTTTGTATTCATAA

Coding sequence    

>SACE0H03212g.cds
ATGCGTCTACTTCGAAGAAACATGTTAGTATTGACACTGCTCGTTTGTGTGTTTTCATCC
ATCATTTCATGCTCAATCCCATTGTCGTCTCGCACCTCAAGGCGGCAGATAGTGGAAGAT
GAAGTTGCCTCCACTAAAAAGCTCAATTTCAACTATGGTGTGGATAAAAATATAAACTCG
CCCATTCCTGCTCCAAGAACCACTGAAGGTTTACCAAATATGAAACTCAGCTCATATCCA
ACTCCTAACTTATTGAATACTGCTGATAATCGACGTGCTAACAAAAAAGGACGTAGGGCT
GCCAATTCTATAAGTGTACCCTATTTGGAGAATCGTTCCTTGAACGAACTGAGTTTATCA
GATATACTAATCGCAGCCGACGTTGAGGGTGGACTTCATGCTGTAGATAGAAGAAATGGT
CATATCATATGGTCAATCGAACCAGAAAATTTTCAACCTCTGATAGAAATACAAGAACCT
TCGAGGTTAGAAACATATGAAACGTTGATTATAGAACCTTTCGGTGATGGGAACATTTAC
TACTTTAACGCCCATCAAGGGTTACAAAAACTGCCTTTATCCATACGACAACTTGTATCA
ACTTCCCCGCTGCACTTGAAAACAAATATTGTGGTTAATGACTCTGGAAAAATTGTTGAA
GATGAAAAGGTCTACACTGGATCGATGAGAACTATAATGTATACTATAAACATGTTGAAT
GGTGAAATTATATCAGCGTTCGGACCTGGTTCAAAAAACGGGTATTTCGGGAGCCAGAGT
GTGGATTGCTCACCTGAGGAGAAGATAAAACTTCAGGAATGTGAAAATATGATTGTAATA
GGCAAAACTATTTTTGAGCTGGGAATTCACTCTTATGATGGAGCAAGCTACAATGTCACT
TACTCTACATGGCAGCAAAATGTTTTAGATGTTCCCCTAGCGCTTCAGAATACATTTTCA
AAGGACGGCATGTGCATAGCGCCTTTCCGTGATAAATCATTGCTAGCAAGCGATTTAGAT
TTTAGAATTGCTAGATGGGTTTCTCCGACATTCCCCGGAATTATTGTTGGGCTTTTCGAT
GTGTTTAATGATCTCCGCACCAATGAAAATATACTGGTACCGCATCCCTTTAATCCTGGT
GATCATGAAAGTATATCGAGTAACAAAGTTTACTTGGATCAGACTTCGAACCTCTCCTGG
TTTGCATTATCTAGTCAGAATTTTCCATCTTTAGTCGAATCAGCTCCCATATCAAGATAC
GCTTCCAGTGACCGTTGGAGGGTGTCTTCAATTTTTGAAGATGAGACTTTATTCAAGAAC
GCAATCATGGGTGTTCATCAGATATATAATAATGAATATGATCACCTTTATGAAAACTAT
GAAAAAACGAATAGTTTGGACACTACGCACAAATATCCACCTCTGATGATTGATTCGTCC
GTTGATACAACCGATTTACATCAGAATAACGAGATGAATTCACTAAAGGAATACATGTCA
CCAGAAGACCTTGAGGCATATAGAAAAAAGATACACGAGCAAATATCGAGAGAATTAGAT
GAAAAGAACCAAAATTCTTTGCTACTGAAGTTTGGAAGTCTAGTATATCGAATTATAGAG
ACTGGAGTATTTCTGTTGTTATTTCTCATTTTTTGTGCAATACTACAAAGATTCAAAATT
TTGCCGCCACTATATGTATTATTATCCAAAATTGGATTTATGCCTGAAAAGGAAATCCCC
ATAGTTGAGTCGAAATCGCTAAATTGTCCCTCTTCATCGGAAAATGTAACCAAGCCATTC
GATATGAAATCAGGGAAGCAAGTTGTTTTTGAAGGTGCTGTGAACGATGGAAGTCTAAAA
TCTGAAAAAGATAACGATGATGCTGATGAAGATGATGAAAAATCACTAGATTTAACCACA
GAAAAGAAGAAGAGGAAAAGAGGTTCGAGAGGAGGCAAAAAGGGCCGAAAATCACGCATT
GCAAATATACCAAACTTTGAGCAATCTTTAAAAAATTTGGTAGTATCCGAAAAAATTTTA
GGTTACGGTTCATCAGGAACAGTAGTTTTTCAGGGAAGTTTTCAAGGAAGACCTGTTGCG
GTAAAGAGAATGTTAATTGATTTTTGTGACATAGCTTTAATGGAAATAAAACTTTTGACT
GAAAGCGATGATCACCCTAACGTCATACGATACTACTGTTCAGAAACAACAGACAGATTT
TTGTATATTGCTTTAGAGCTCTGCAATTTGAACCTTCAAGATTTGGTGGAGTCTAAGAAT
GTATCAGATGAAAACCTGAAATTACAGAAAGAGTATAATCCAATTTCGTTATTGAGACAA
ATAGCGTCCGGGGTAGCACATTTACATTCTTTAAAGATTATCCATCGAGATTTAAAGCCT
CAAAATATTCTCGTTTCTACTTCGAGTAGGTTTACTGCCGATCAGCAAACAGGAGCAGAA
AATCTTCGAATTTTGATATCAGACTTTGGTCTTTGCAAAAAACTAGACTCTGGTCAGTCT
TCATTTAGAACAAATTTGAATAACCCTTCTGGCACAAGTGGTTGGAGGGCCCCAGAGCTG
CTTGAAGAATCAAACAATTTGCAGTGCCAAGTCGAAACGGAACACTCTTCTAGTAGGCAT
ACAGTAGTTTCATCTGATTCTTTTTATGATCCGTTCACCAAGAGGAGGCTAACAAGATCT
ATTGATATTTTTTCTATGGGATGTGTATTCTATTATATCCTATCCAAAGGGAAGCATCCA
TTTGGAGATAAATATTCACGTGAAAGCAATATCATAAGAGGAATATTCAGTCTTGATGAA
ATGAAATGTCTACATGATAGATCCTTAATTGCAGAAGCTACAGATCTGATCTCCCAAATG
ATTGATCACGATCCGTTAAAAAGACCTACTGCTATGAAAGTTCTAAGGCATCCGTTGTTT
TGGCCAAAGTCGAAAAAATTGGAGTTCCTTTTAAAAGTTAGTGATAGGCTTGAAATTGAA
AACAGAGACCCTCCAAGTGCCCTGTTAATGAAATTTGACGCCGGTTCTGACTTTGTAATA
CCCAGTGGAGATTGGACTGTCAAGTTTGATAAAACATTCATGGACAACCTTGAAAGGTAC
AGAAAATACCATTCATCAAAGTTAATGGATCTATTAAGAGCACTTAGGAATAAATATCAT
CATTTTATGGATTTACCTGAAGATATAGCAGAACTAATGGGGCCGGTACCCGATGGATTT
TACGATTACTTCACCAAGCGTTTTCCAAACCTATTAATAGGTGTTTATATGATTGTCAAG
GAAAATTTAAGTGACGATCAAATTTTACGTGAATTTTTGTATTCATAA

Predicted translation product    

>SACE0H03212g.aa
MRLLRRNMLVLTLLVCVFSSIISCSIPLSSRTSRRQIVEDEVASTKKLNFNYGVDKNINS
PIPAPRTTEGLPNMKLSSYPTPNLLNTADNRRANKKGRRAANSISVPYLENRSLNELSLS
DILIAADVEGGLHAVDRRNGHIIWSIEPENFQPLIEIQEPSRLETYETLIIEPFGDGNIY
YFNAHQGLQKLPLSIRQLVSTSPLHLKTNIVVNDSGKIVEDEKVYTGSMRTIMYTINMLN
GEIISAFGPGSKNGYFGSQSVDCSPEEKIKLQECENMIVIGKTIFELGIHSYDGASYNVT
YSTWQQNVLDVPLALQNTFSKDGMCIAPFRDKSLLASDLDFRIARWVSPTFPGIIVGLFD
VFNDLRTNENILVPHPFNPGDHESISSNKVYLDQTSNLSWFALSSQNFPSLVESAPISRY
ASSDRWRVSSIFEDETLFKNAIMGVHQIYNNEYDHLYENYEKTNSLDTTHKYPPLMIDSS
VDTTDLHQNNEMNSLKEYMSPEDLEAYRKKIHEQISRELDEKNQNSLLLKFGSLVYRIIE
TGVFLLLFLIFCAILQRFKILPPLYVLLSKIGFMPEKEIPIVESKSLNCPSSSENVTKPF
DMKSGKQVVFEGAVNDGSLKSEKDNDDADEDDEKSLDLTTEKKKRKRGSRGGKKGRKSRI
ANIPNFEQSLKNLVVSEKILGYGSSGTVVFQGSFQGRPVAVKRMLIDFCDIALMEIKLLT
ESDDHPNVIRYYCSETTDRFLYIALELCNLNLQDLVESKNVSDENLKLQKEYNPISLLRQ
IASGVAHLHSLKIIHRDLKPQNILVSTSSRFTADQQTGAENLRILISDFGLCKKLDSGQS
SFRTNLNNPSGTSGWRAPELLEESNNLQCQVETEHSSSRHTVVSSDSFYDPFTKRRLTRS
IDIFSMGCVFYYILSKGKHPFGDKYSRESNIIRGIFSLDEMKCLHDRSLIAEATDLISQM
IDHDPLKRPTAMKVLRHPLFWPKSKKLEFLLKVSDRLEIENRDPPSALLMKFDAGSDFVI
PSGDWTVKFDKTFMDNLERYRKYHSSKLMDLLRALRNKYHHFMDLPEDIAELMGPVPDGF
YDYFTKRFPNLLIGVYMIVKENLSDDQILREFLYS*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites