KLTH0G10384g


highly similar to uniprot|P40495 Saccharomyces cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase an NAD-linked mitochondrial enzyme required for the fourth step in the biosynthesis of lysine in which homo- isocitrate is oxidatively decarboxylated to alpha- ketoadipate

Genomic environment map

Element type: CDS
Element length: 1104 nucleotides,
on anti-sense strand of
Klth0G: complement(878375..879478).
Other names:
KLTH-ORF3666
Coding sequence: 368 codons.
Database cross references:
EMBL: CU928171
GeneID: 8293763
GenomeReviews: CU928171_GR

Computed results  

None available yet


Protein KLTH0G10384p  


highly similar to uniprot|P40495 Saccharomyces cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase an NAD-linked mitochondrial enzyme required for the fourth step in the biosynthesis of lysine in which homo- isocitrate is oxidatively decarboxylated to alpha- ketoadipate; SubName: Full=KLTH0G10384p;

Protein domain map

Protein length: 367 amino acids
Protein family: GL3C0069
Database cross references:
Gene3D: G3DSA:3.40.718.10
InterPro: IPR001804
InterPro: IPR019818
InterPro: IPR024084
KEGG: lth:KLTH0G10384g
PANTHER: PTHR11835
PROSITE: PS00470
Pfam: PF00180
RefSeq: XP_002555485.1
UniProtKB/TrEMBL: C5DMN7
UniProtKB: C5DMN7_LACTC

Phylogeny  

PhylomeDB:KLTH0G10384g

Computed results for KLTH0G10384p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>KLTH0G10384g.nt
ATGCTGAGAGCTTCTTTTACCCAACTGGCGCGTCGCTCCTACGCGTCCGCTTCCAAGTCT
CTAACAATTGGTTTAATTCCAGGTGATGGTATCGGTAAAGAAGTGATTCCTGCGGGCAGA
CAAGTTTTGGAGAACCTTTCCAGTAAGCACGGTCTGAAATTCGACTTCATCGACCTGCAG
GCTGGGTGGCAGACTTTCCAGGAAACTGGAAAAGCGCTGCCAGATGAAACTATCGACATC
CTGAGAAATCAGTGCCAAGGTGCTCTGTTTGGCGCTGTGCAGTCGCCAACTAACAAAGTT
GAAGGCTACTCGTCACCCATTGTGGCTCTGAGGAAAAAGCTTGGGCTATATGCCAACGTA
CGTCCCGTCAAGTCCGTCTTGCCACAAGAGAGACCTGTCGATATGATTATCGTGAGAGAA
AACACCGAGGATCTGTACATCAAGACTGAGAAAACCTACATTGACGAAAAAACCGGCACT
CGTGTTGCTGAGGCCATCAAAAGAATTTCAGAGACTGCTACCAAGAACATCGCCAACATC
GCTTTGGAGATTGCTCTGCAAAGGCAGAAGGTTAACGGAGAGGCCACTTTGACTGTTACA
CACAAGTCCAACGTGCTTTCTCAAAGTGACGGTTTGTTCAGAGAAGTCTGCAGACAAGTT
TACGAAAGCAACAAAGACAAGTTTGGCTCTATCAAATACAACGAACAGATTGTTGACTCA
ATGGTTTACAGGATGTTCAGGGAGCCAGAGTGCTTCGACGTTATTGTTGCCCCCAACTTG
TATGGTGACATTTTGTCCGATGGTGCTGCTGCGCTCGTGGGTTCGCTTGGTGTCGTGCCA
AGCGCCAACGTTGGCTTCGACTTTGTAGTCGGAGAGCCATGTCACGGTTCTGCCCCAGAC
ATCGCGGGCAAGGGTATATCTAACCCTGTTGCGACCATCAGATCCACCGCCTTGATGTTG
GAGTTTATGGGCCATCCAGAAGCTGCTCAAGACATCCACAAAGCTGTCGACGCAAACCTG
CGTGACAACTCTATCAAGACACCAGACCTTGGCGGCAAATCAACTACCCAACAAGTAGTC
GAAGATGTTCTCTCCAGAATGTAA

Coding sequence    

>KLTH0G10384g.cds
ATGCTGAGAGCTTCTTTTACCCAACTGGCGCGTCGCTCCTACGCGTCCGCTTCCAAGTCT
CTAACAATTGGTTTAATTCCAGGTGATGGTATCGGTAAAGAAGTGATTCCTGCGGGCAGA
CAAGTTTTGGAGAACCTTTCCAGTAAGCACGGTCTGAAATTCGACTTCATCGACCTGCAG
GCTGGGTGGCAGACTTTCCAGGAAACTGGAAAAGCGCTGCCAGATGAAACTATCGACATC
CTGAGAAATCAGTGCCAAGGTGCTCTGTTTGGCGCTGTGCAGTCGCCAACTAACAAAGTT
GAAGGCTACTCGTCACCCATTGTGGCTCTGAGGAAAAAGCTTGGGCTATATGCCAACGTA
CGTCCCGTCAAGTCCGTCTTGCCACAAGAGAGACCTGTCGATATGATTATCGTGAGAGAA
AACACCGAGGATCTGTACATCAAGACTGAGAAAACCTACATTGACGAAAAAACCGGCACT
CGTGTTGCTGAGGCCATCAAAAGAATTTCAGAGACTGCTACCAAGAACATCGCCAACATC
GCTTTGGAGATTGCTCTGCAAAGGCAGAAGGTTAACGGAGAGGCCACTTTGACTGTTACA
CACAAGTCCAACGTGCTTTCTCAAAGTGACGGTTTGTTCAGAGAAGTCTGCAGACAAGTT
TACGAAAGCAACAAAGACAAGTTTGGCTCTATCAAATACAACGAACAGATTGTTGACTCA
ATGGTTTACAGGATGTTCAGGGAGCCAGAGTGCTTCGACGTTATTGTTGCCCCCAACTTG
TATGGTGACATTTTGTCCGATGGTGCTGCTGCGCTCGTGGGTTCGCTTGGTGTCGTGCCA
AGCGCCAACGTTGGCTTCGACTTTGTAGTCGGAGAGCCATGTCACGGTTCTGCCCCAGAC
ATCGCGGGCAAGGGTATATCTAACCCTGTTGCGACCATCAGATCCACCGCCTTGATGTTG
GAGTTTATGGGCCATCCAGAAGCTGCTCAAGACATCCACAAAGCTGTCGACGCAAACCTG
CGTGACAACTCTATCAAGACACCAGACCTTGGCGGCAAATCAACTACCCAACAAGTAGTC
GAAGATGTTCTCTCCAGAATGTAA

Predicted translation product    

>KLTH0G10384g.aa
MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ
AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV
RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI
ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS
MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD
IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVV
EDVLSRM*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites