KLTH0A04004g


highly similar to uniprot|P10869 Saccharomyces cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate 4-P- transferase) cytoplasmic enzyme that catalyzes the first step in the common pathway for methionine and threonine biosynthesis expression regulated by Gcn4p and the general control of amino acid synthesis

Genomic environment map

Element type: CDS
Element length: 1569 nucleotides,
on anti-sense strand of
Klth0A: complement(335054..336622).
Other names:
KLTH-ORF16594
Coding sequence: 523 codons.
Database cross references:
EMBL: CU928165
GeneID: 8290433
GenomeReviews: CU928165_GR

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3R1819
Orthologs: strict determination not possible; homologs must be refined manually

Protein KLTH0A04004p  


highly similar to uniprot|P10869 Saccharomyces cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate 4-P- transferase) cytoplasmic enzyme that catalyzes the first step in the common pathway for methionine and threonine biosynthesis expression regulated by Gcn4p and the general control of amino acid synthesis; RecName: Full=Aspartokinase; EC=2.7.2.4;

Protein domain map

Protein length: 522 amino acids
Protein family: GL3R1819
Database cross references:
Gene3D: G3DSA:3.40.1160.10
InterPro: IPR001048
InterPro: IPR001341
InterPro: IPR002912
InterPro: IPR018042
KEGG: lth:KLTH0A04004g
PROSITE: PS00324
Pfam: PF00696
Pfam: PF01842
RefSeq: XP_002551630.1
TIGRFAMs: TIGR00657
UniProtKB/TrEMBL: C5DBN1
UniProtKB: C5DBN1_LACTC

Phylogeny  

PhylomeDB:KLTH0A04004g

Computed results for KLTH0A04004p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>KLTH0A04004g.nt
ATGGCTCTTCAAACAAATTGGATCGTCCAGAAATTTGGCGGGACCAGTGTCGGTAAATTT
CCCGAGCAAATAGTCGATGAAATCGTGAAAGTCTACACAACGCAGTTCAAGAACAACGTG
GCTGTAGTGTGTTCTGCGCGCTCAAGCGATACTAAGGCCGAGGGAACCACTTCGCGTCTT
TTGAGAGCATGTGACCTAGTGTGTAACAGCGACCCAAGCTTCGCTGAGGTCCTGCAGAAG
GTGAGAGACGACCATATCTCGAACGCCAAACAGCGCATCAGCAACCCTGAGCTGCAGAAG
AAGTTGATTCAAGATACCATTGCGGAGCTAGATTTGGTTGAAAAATACCTCAATGCGTCG
CAAGTTTTGGGCGAGGTGTCGCTGAGGACAATGGATCTCGTCATGTCGTGCGGTGAGAAG
CTCAGCTGCTTGTTCATGGCTGCCTTGTGTAACGAACACGGAGTTCCAGCGCAGTACGTG
GATTTGTCTTCAGTTATTCCCCACGATTACGAATGCCGGCAGGGCACCCTGGATACCAGC
TTCTACACATTTTTAGTGATGGCTTTCAAGGAGAAACTGCAACCTGTTCTTGATCTACAT
GCCAAAGGCGAGCCCGTCGTTCCTGTTATTACTGGGTTCTTTGGTCTGGTCCCCATGGGT
CTTCTGAATGGTGTTGGTCGTGGGTACACTGACCTTTGCGCAGCCTTGATCGCTGTCGGC
CTCAACGCCGACGAGCTTCAAGTTTGGAAAGAAGTCGATGGTATCTTCACAGCAGACCCT
CGTAAGGTGCCACAGGCTAGACTCCTTGCCAGCGTTACTCCAGAAGAGGCCTCCGAGTTG
ACCTACTACGGTTCTGAGGTTATCCACCCATTCACCATGGAGCAGGTTATCAGAGCCAAG
ATTCCAATCAGAATCAAGAACGTTCAGAACCCTAGAGGCGACGGCACTGTTATTTATCCT
GACAATGTCGCAAAGAAGGGTGAATCTACTCCTCCTCACCCACCAGTCACATTGAGCAAC
TCCTTCTTTGAGCAGAGGAGGCGTGGTGCTACAGCCATCACCAGCAAAAGTGACATATAC
GTTGTCAGCATTCATTCCAATAAAAAGACATTGTCGCACGGCTTCTTGGCCCAAATATTT
ACCACACTGGACAAATACAAGCTGGTTGTAGATTTGATTTCTACTTCCGAGGTTCATGTT
TCCATGGCTTTGCCCGTGCCGGACAACGACTCGGCGAAAGCTCTGAAGAAGGCTGTCGAG
GAGCTGAAAAAGCTCGGGTCAGTTGAACTCACTAAGAAACTTGTCATTATTTCGTTGGTC
GGTAAGCAAATGAAACAGTTTATTGGTATCGCCGGTACGATGTTCACAACCCTGGCCGAG
CAAGGCATTAATATCGAGATGATTTCTCAGGGTGCTAACGAGATCAACATCTCCTGCGTG
ATCGATGAAGACAATGCCATTAAGGCTCTGCAGTCAATTCACTCGAAACTTTTGGACCTG
AACACAGAGGTTGAGCTTGGGAAAGCTGTGAACGAAAAACTCGAGCAGATCAAGAGACTT
GCGCTGTAA

Coding sequence    

>KLTH0A04004g.cds
ATGGCTCTTCAAACAAATTGGATCGTCCAGAAATTTGGCGGGACCAGTGTCGGTAAATTT
CCCGAGCAAATAGTCGATGAAATCGTGAAAGTCTACACAACGCAGTTCAAGAACAACGTG
GCTGTAGTGTGTTCTGCGCGCTCAAGCGATACTAAGGCCGAGGGAACCACTTCGCGTCTT
TTGAGAGCATGTGACCTAGTGTGTAACAGCGACCCAAGCTTCGCTGAGGTCCTGCAGAAG
GTGAGAGACGACCATATCTCGAACGCCAAACAGCGCATCAGCAACCCTGAGCTGCAGAAG
AAGTTGATTCAAGATACCATTGCGGAGCTAGATTTGGTTGAAAAATACCTCAATGCGTCG
CAAGTTTTGGGCGAGGTGTCGCTGAGGACAATGGATCTCGTCATGTCGTGCGGTGAGAAG
CTCAGCTGCTTGTTCATGGCTGCCTTGTGTAACGAACACGGAGTTCCAGCGCAGTACGTG
GATTTGTCTTCAGTTATTCCCCACGATTACGAATGCCGGCAGGGCACCCTGGATACCAGC
TTCTACACATTTTTAGTGATGGCTTTCAAGGAGAAACTGCAACCTGTTCTTGATCTACAT
GCCAAAGGCGAGCCCGTCGTTCCTGTTATTACTGGGTTCTTTGGTCTGGTCCCCATGGGT
CTTCTGAATGGTGTTGGTCGTGGGTACACTGACCTTTGCGCAGCCTTGATCGCTGTCGGC
CTCAACGCCGACGAGCTTCAAGTTTGGAAAGAAGTCGATGGTATCTTCACAGCAGACCCT
CGTAAGGTGCCACAGGCTAGACTCCTTGCCAGCGTTACTCCAGAAGAGGCCTCCGAGTTG
ACCTACTACGGTTCTGAGGTTATCCACCCATTCACCATGGAGCAGGTTATCAGAGCCAAG
ATTCCAATCAGAATCAAGAACGTTCAGAACCCTAGAGGCGACGGCACTGTTATTTATCCT
GACAATGTCGCAAAGAAGGGTGAATCTACTCCTCCTCACCCACCAGTCACATTGAGCAAC
TCCTTCTTTGAGCAGAGGAGGCGTGGTGCTACAGCCATCACCAGCAAAAGTGACATATAC
GTTGTCAGCATTCATTCCAATAAAAAGACATTGTCGCACGGCTTCTTGGCCCAAATATTT
ACCACACTGGACAAATACAAGCTGGTTGTAGATTTGATTTCTACTTCCGAGGTTCATGTT
TCCATGGCTTTGCCCGTGCCGGACAACGACTCGGCGAAAGCTCTGAAGAAGGCTGTCGAG
GAGCTGAAAAAGCTCGGGTCAGTTGAACTCACTAAGAAACTTGTCATTATTTCGTTGGTC
GGTAAGCAAATGAAACAGTTTATTGGTATCGCCGGTACGATGTTCACAACCCTGGCCGAG
CAAGGCATTAATATCGAGATGATTTCTCAGGGTGCTAACGAGATCAACATCTCCTGCGTG
ATCGATGAAGACAATGCCATTAAGGCTCTGCAGTCAATTCACTCGAAACTTTTGGACCTG
AACACAGAGGTTGAGCTTGGGAAAGCTGTGAACGAAAAACTCGAGCAGATCAAGAGACTT
GCGCTGTAA

Predicted translation product    

>KLTH0A04004g.aa
MALQTNWIVQKFGGTSVGKFPEQIVDEIVKVYTTQFKNNVAVVCSARSSDTKAEGTTSRL
LRACDLVCNSDPSFAEVLQKVRDDHISNAKQRISNPELQKKLIQDTIAELDLVEKYLNAS
QVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEHGVPAQYVDLSSVIPHDYECRQGTLDTS
FYTFLVMAFKEKLQPVLDLHAKGEPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG
LNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIRAK
IPIRIKNVQNPRGDGTVIYPDNVAKKGESTPPHPPVTLSNSFFEQRRRGATAITSKSDIY
VVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDNDSAKALKKAVE
ELKKLGSVELTKKLVIISLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV
IDEDNAIKALQSIHSKLLDLNTEVELGKAVNEKLEQIKRLAL*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites