KLLA0F16775g


highly similar to uniprot|P37303 Saccharomyces cerevisiae YEL046C GLY1 Threonine aldolase catalyzes the cleavage of L-allo-threonine and L-threonine to glycine involved in glycine biosynthesis

Genomic environment map

Element type: CDS
Element length: 1188 nucleotides,
on anti-sense strand of
Klla0F: complement(1544839..1546026).
Other names:
KLLA-ORF1029
Coding sequence: 396 codons.
Database cross references:
EMBL: CR382126
GeneID: 2895652
GenomeReviews: CR382126_GR
HOGENOM: HBG293912

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3R0527
Orthologs: strict determination not possible; homologs must be refined manually

Protein KLLA0F16775p  


highly similar to uniprot|P37303 Saccharomyces cerevisiae YEL046C GLY1 Threonine aldolase catalyzes the cleavage of L-allo-threonine and L-threonine to glycine involved in glycine biosynthesis; SubName: Full=KLLA0F16775p;

Protein domain map

Protein length: 395 amino acids
Protein family: GL3R0527
Database cross references:
Gene3D: G3DSA:3.40.640.10
Gene3D: G3DSA:3.90.1150.10
InterPro: IPR001597
InterPro: IPR015421
InterPro: IPR015422
InterPro: IPR015424
InterPro: IPR023603
KEGG: kla:KLLA0F16775g
PIRSF: PIRSF017617
Pfam: PF01212
RefSeq: XP_455833.1
UniProtKB/TrEMBL: Q6CJQ6
UniProtKB: Q6CJQ6_KLULA

Phylogeny  

PhylomeDB:KLLA0F16775g

Computed results for KLLA0F16775p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>KLLA0F16775g.nt
ATGACTGCTTCTGATAAGAAATCTACTGCTGCTGCTCCTTCAGAGCCAGCTTACACCTCA
GCTGCCAATGACCTTCGGTCTGATACTTTCACCACTCCAACTAAGGAAATGTTGGAAGCT
GCTTTCAATGCTTCCATCGGTGATGCAGTCTATAACGAAGACGTCGACACCATTGAGCTA
GAAACCGTCGTAGCTCGTTTAGCTGGTAAAGAAGCCGGGTTATTCTGTGTCTCTGGTACT
TTATCGAACCAAATTGGTTTGAGAACGCATCTATTCCAACCTCCATACTCTATCTTGTGT
GATTACAGAGCTCATGTTTATACTCATGAAGCAGCTGGGTTGGCAATCTTGTCTCAAGCG
ATGGTCACTCCGGTGATCCCATCTAACGGTGATTATATGACTTTGGAAGATATCAAGGCT
CATTACATCCCGGACGACGGGGATATTCACGGTGCGCCAACAAGAGTGTTATCGTTGGAA
AACACTTTGCACGGTATCGTTTACCCATTGGAAGAATTGATCCGTATCAAAGGGTGGTGT
TTGGAAAACGATATCAAATTACACTGTGACGGTGCTAGAATTTGGAACGCAGTTGTCGAA
TCCGGTGTCTCTTTGAAACAGTACGGTGAAATTTTCGACTCTATCTCCATTTGTCTATCT
AAGTCCATGGGTGCTCCAATGGGGTCTGTTCTTGTTGGTAGCAACAAGTTTGTCAAGAAA
TGTAACCATTTCAGAAAACAACAAGGTGGTGGTGTTAGACAATCAGGTATTATGTGCAGA
ATGGCACTTTGCGCTGTGAACGGTGACTGGAAGACTAAGATGGGATACTCTCACCAGTTG
GCCCACGAATTGGCTAAATTCTGTAAAGATAACGGTATTCCATTGGAGTCTCCAGCTGAC
ACCAACTTCGTCTTCTTGGACTTGCAAAAGGCAAAGATGAACCCAGACGTTCTTGTCAAG
AAAGGTTTGAAATATGGGGTCAAATTGATGGGTGGTAGAGTTTCTTTCCACTACCAAGTC
ACCAGAGAAACTTTGGAAAATGTTAAGTCTGCTGTCTTGGAAACTTTCCAATACGCAAAG
GAAAACCCATTCGACACTAACGGTCCAACAAAAATCTACCGTAGTGAATCTACTGATTTT
GATATCCATGGTAACCCTATCAGTGATATCAAGACTTACAAGTACTGA

Coding sequence    

>KLLA0F16775g.cds
ATGACTGCTTCTGATAAGAAATCTACTGCTGCTGCTCCTTCAGAGCCAGCTTACACCTCA
GCTGCCAATGACCTTCGGTCTGATACTTTCACCACTCCAACTAAGGAAATGTTGGAAGCT
GCTTTCAATGCTTCCATCGGTGATGCAGTCTATAACGAAGACGTCGACACCATTGAGCTA
GAAACCGTCGTAGCTCGTTTAGCTGGTAAAGAAGCCGGGTTATTCTGTGTCTCTGGTACT
TTATCGAACCAAATTGGTTTGAGAACGCATCTATTCCAACCTCCATACTCTATCTTGTGT
GATTACAGAGCTCATGTTTATACTCATGAAGCAGCTGGGTTGGCAATCTTGTCTCAAGCG
ATGGTCACTCCGGTGATCCCATCTAACGGTGATTATATGACTTTGGAAGATATCAAGGCT
CATTACATCCCGGACGACGGGGATATTCACGGTGCGCCAACAAGAGTGTTATCGTTGGAA
AACACTTTGCACGGTATCGTTTACCCATTGGAAGAATTGATCCGTATCAAAGGGTGGTGT
TTGGAAAACGATATCAAATTACACTGTGACGGTGCTAGAATTTGGAACGCAGTTGTCGAA
TCCGGTGTCTCTTTGAAACAGTACGGTGAAATTTTCGACTCTATCTCCATTTGTCTATCT
AAGTCCATGGGTGCTCCAATGGGGTCTGTTCTTGTTGGTAGCAACAAGTTTGTCAAGAAA
TGTAACCATTTCAGAAAACAACAAGGTGGTGGTGTTAGACAATCAGGTATTATGTGCAGA
ATGGCACTTTGCGCTGTGAACGGTGACTGGAAGACTAAGATGGGATACTCTCACCAGTTG
GCCCACGAATTGGCTAAATTCTGTAAAGATAACGGTATTCCATTGGAGTCTCCAGCTGAC
ACCAACTTCGTCTTCTTGGACTTGCAAAAGGCAAAGATGAACCCAGACGTTCTTGTCAAG
AAAGGTTTGAAATATGGGGTCAAATTGATGGGTGGTAGAGTTTCTTTCCACTACCAAGTC
ACCAGAGAAACTTTGGAAAATGTTAAGTCTGCTGTCTTGGAAACTTTCCAATACGCAAAG
GAAAACCCATTCGACACTAACGGTCCAACAAAAATCTACCGTAGTGAATCTACTGATTTT
GATATCCATGGTAACCCTATCAGTGATATCAAGACTTACAAGTACTGA

Predicted translation product    

>KLLA0F16775g.aa
MTASDKKSTAAAPSEPAYTSAANDLRSDTFTTPTKEMLEAAFNASIGDAVYNEDVDTIEL
ETVVARLAGKEAGLFCVSGTLSNQIGLRTHLFQPPYSILCDYRAHVYTHEAAGLAILSQA
MVTPVIPSNGDYMTLEDIKAHYIPDDGDIHGAPTRVLSLENTLHGIVYPLEELIRIKGWC
LENDIKLHCDGARIWNAVVESGVSLKQYGEIFDSISICLSKSMGAPMGSVLVGSNKFVKK
CNHFRKQQGGGVRQSGIMCRMALCAVNGDWKTKMGYSHQLAHELAKFCKDNGIPLESPAD
TNFVFLDLQKAKMNPDVLVKKGLKYGVKLMGGRVSFHYQVTRETLENVKSAVLETFQYAK
ENPFDTNGPTKIYRSESTDFDIHGNPISDIKTYKY*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites