KLLA0F04103g


uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1 Isocitrate dehydrogenase subunit 1

Genomic environment map

Element type: CDS
Element length: 1086 nucleotides,
on sense strand of
Klla0F: 389159..390244.
Other names:
KLLA-ORF2209
Coding sequence: 362 codons.
Database cross references:
EMBL: AF045153
EMBL: CR382126
GeneID: 2894997
GenomeReviews: CR382126_GR
HOGENOM: HBG518924

Computed results  

None available yet


Protein KLLA0F04103p  


uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1 Isocitrate dehydrogenase subunit 1; RecName: Full=Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial; EC=1.1.1.41; AltName: Full=Isocitric dehydrogenase; AltName: Full=NAD(+)-specific ICDH; Flags: Precursor;

Protein domain map

Protein length: 361 amino acids
Protein family: GL3C0069
Database cross references:
Gene3D: G3DSA:3.40.718.10
InterPro: IPR001804
InterPro: IPR004434
InterPro: IPR019818
InterPro: IPR024084
KEGG: kla:KLLA0F04103g
PANTHER: PTHR11835
PANTHER: PTHR11835:SF5
PROSITE: PS00470
Pfam: PF00180
RefSeq: XP_455266.1
SMR: O94229
TIGRFAMs: TIGR00175
UniProtKB/Swiss-Prot: O94229
UniProtKB: IDH1_KLULA

Computed results for KLLA0F04103p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>KLLA0F04103g.nt
ATGTTGAGACAAGGTATTGCTGCTCAAAAAAAGTCCTTCGCTACCCTAGCAGCTGAACAA
TTGTTGCCAAAGAAGTACGGTGGTCGCTACACTGTAACTTTGATTCCAGGTGATGGTGTT
GGTAAGGAAGTGACCGACTCAGTAGTCAAGATCTTCGAAAACGAAAATATTCCAATCGAC
TGGGAAACTATCGACATTTCTGGTCTAGAAAACACTGAAAATGTACAAAGAGCTGTCGAA
TCTTTAAAGAGAAACAAGGTTGGTTTGAAAGGTATCTGGCACACTCCAGCCGACCAAACC
GGTCATGGCTCATTGAACGTTGCTTTGAGAAAGCAACTGGATATTTTCGCCAATGTCGCC
TTGTTCAAATCAATTCCAGGTGTCAAGACTAGATTGAATAACATCGACATGGTTATCATC
AGAGAAAACACTGAAGGTGAATACTCTGGTTTAGAACACGAATCTGTTCCAGGTGTCGTT
GAATCTTTGAAGATCATGACCAGGGCTAAGTCAGAAAGAATTGCTAGATTCGCCTTTGAT
TTCGCCTTGAAAAACAACAGAAAGTCGGTCTGCGCTGTTCACAAAGCTAACATCATGAAA
TTGGGTGATGGTTTGTTCAGAAACACCGTTAATGAAATTGGTGCTAACGAATACCCAGAA
CTCGATGTCAAGAACATCATCGTTGACAACGCTTCCATGCAAGCTGTTGCCAAGCCACAT
CAATTCGATGTTTTGGTGACACCAAACTTGTACGGTTCTATCTTGGGTAACATTGGTTCT
GCTTTGATCGGTGGTCCCGGTCTAGTCCCAGGTGCTAACTTCGGTAGAGAATACGCTGTC
TTTGAACCAGGTTCCAGACATGTTGGTTTGGACATCAAGGGTCAAAACGTTGCTAACCCA
ACTGCTATGATCTTGTCCTCTACTCTAATGTTGAGACATCTAGGTTTGAACGCTTACGCT
GATAGAATTTCCAAAGCTACATATGATGTCATTTCTGAAGGTAAGTCAACAACAAGAGAC
ATCGGTGGTTCAGCCTCCACTTCTGAGTTCACCAACGCTGTTATCGAGAAGTTAGCCAAG
TTATGA

Coding sequence    

>KLLA0F04103g.cds
ATGTTGAGACAAGGTATTGCTGCTCAAAAAAAGTCCTTCGCTACCCTAGCAGCTGAACAA
TTGTTGCCAAAGAAGTACGGTGGTCGCTACACTGTAACTTTGATTCCAGGTGATGGTGTT
GGTAAGGAAGTGACCGACTCAGTAGTCAAGATCTTCGAAAACGAAAATATTCCAATCGAC
TGGGAAACTATCGACATTTCTGGTCTAGAAAACACTGAAAATGTACAAAGAGCTGTCGAA
TCTTTAAAGAGAAACAAGGTTGGTTTGAAAGGTATCTGGCACACTCCAGCCGACCAAACC
GGTCATGGCTCATTGAACGTTGCTTTGAGAAAGCAACTGGATATTTTCGCCAATGTCGCC
TTGTTCAAATCAATTCCAGGTGTCAAGACTAGATTGAATAACATCGACATGGTTATCATC
AGAGAAAACACTGAAGGTGAATACTCTGGTTTAGAACACGAATCTGTTCCAGGTGTCGTT
GAATCTTTGAAGATCATGACCAGGGCTAAGTCAGAAAGAATTGCTAGATTCGCCTTTGAT
TTCGCCTTGAAAAACAACAGAAAGTCGGTCTGCGCTGTTCACAAAGCTAACATCATGAAA
TTGGGTGATGGTTTGTTCAGAAACACCGTTAATGAAATTGGTGCTAACGAATACCCAGAA
CTCGATGTCAAGAACATCATCGTTGACAACGCTTCCATGCAAGCTGTTGCCAAGCCACAT
CAATTCGATGTTTTGGTGACACCAAACTTGTACGGTTCTATCTTGGGTAACATTGGTTCT
GCTTTGATCGGTGGTCCCGGTCTAGTCCCAGGTGCTAACTTCGGTAGAGAATACGCTGTC
TTTGAACCAGGTTCCAGACATGTTGGTTTGGACATCAAGGGTCAAAACGTTGCTAACCCA
ACTGCTATGATCTTGTCCTCTACTCTAATGTTGAGACATCTAGGTTTGAACGCTTACGCT
GATAGAATTTCCAAAGCTACATATGATGTCATTTCTGAAGGTAAGTCAACAACAAGAGAC
ATCGGTGGTTCAGCCTCCACTTCTGAGTTCACCAACGCTGTTATCGAGAAGTTAGCCAAG
TTATGA

Predicted translation product    

>KLLA0F04103g.aa
MLRQGIAAQKKSFATLAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPID
WETIDISGLENTENVQRAVESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVA
LFKSIPGVKTRLNNIDMVIIRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFD
FALKNNRKSVCAVHKANIMKLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPH
QFDVLVTPNLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANP
TAMILSSTLMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKLAK
L*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites