KLLA0E01585g


similar to uniprot|P39009 Saccharomyces cerevisiae YDL101C DUN1 Cell-cycle checkpoint serine-threonine kinase required for DNA damage-induced transcription of certain target genes phosphorylation of Rad55p and Sml1p and transient G2/M arrest after DNA damage also regulates postreplicative DNA repair

Genomic environment map

Element type: CDS
Element length: 1656 nucleotides,
on sense strand of
Klla0E: join(149305..149370,149488..150960).
Other names:
Klla0E.mRNA.67.p
Coding sequence: 513 codons.
Database cross references:
EMBL: CR382125
GeneID: 9487424
GenomeReviews: CR382125_GR
HOGENOM: HBG397469

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3M4597
Orthologs: strict determination not possible; homologs must be refined manually

Protein KLLA0E01585p  


similar to uniprot|P39009 Saccharomyces cerevisiae YDL101C DUN1 Cell-cycle checkpoint serine-threonine kinase required for DNA damage-induced transcription of certain target genes phosphorylation of Rad55p and Sml1p and transient G2/M arrest after DNA damage also regulates postreplicative DNA repair; SubName: Full=KLLA0E01585p;

Protein domain map

Protein length: 512 amino acids
Protein family: GL3M4597
Database cross references:
Gene3D: G3DSA:2.60.200.20
InterPro: IPR000253
InterPro: IPR000719
InterPro: IPR002290
InterPro: IPR008271
InterPro: IPR008984
InterPro: IPR011009
InterPro: IPR017441
InterPro: IPR017442
InterPro: IPR020636
InterPro: IPR020648
KEGG: kla:KLLA0E01585g
PROSITE: PS00107
PROSITE: PS00108
PROSITE: PS50006
PROSITE: PS50011
Pfam: PF00069
Pfam: PF00498
RefSeq: XP_002999388.1
SMART: SM00220
SMART: SM00240
UniProtKB/TrEMBL: B4UNA3
UniProtKB: B4UNA3_KLULA

Computed results for KLLA0E01585p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>KLLA0E01585g.nt
ATGTCACCTAGTGAAGTATTCTCGTGCAAATATCAGTCATTATCAATGAATCCAGCAGTG
AAGCGAgtatgtctcaaatatttatttatctctctcaattaactaacgcagtgtgtttac
taacaggtatgggatcatcttatttagagaaactcagatgaagaatttaaacctgacaac
aagAGGGCTCAACAGGATACCCAAAGTTCAAACAATAATCAGAGAATCATTGCAACACTT
CTTAGTTTGATACCAGATAGAGAACAGAAAATTCAGTTAGTTGACATTCCGACAATTTCC
GTTGGAAGAAGTCGATCATGTAACATCGTACTTTCAGAGCCAGATATCTCAACCATACAT
GCTGAACTGTACACCATTGAGGTACAAATTAACGGATTCAAGCGTAAAATGATCAATATC
ACCGATAAAAGCCGTAATGGAACGTTTGTGAACGGTGATAGGCTCATCAGAAAAGACTAT
GTTTTAAAGAATGGTGATAAAATAGTATTCGGGAAAAGCTGTTCATATCTTTTCAAATAT
GCTACACTTACAGAAAATGGACTAAGTCAAACAACAGCCACTCAAATTTCACAAACTACG
CAAAACAGCGATTATGATGGGGTTTTCAGAAAACCTTTATTCAGTAGTCAAAATACAACC
AAGAAACTATCAAGAACAAGGGAGCAGCCCAGATCCTTTTTCGACAAATACTTAGCTGGG
AAAGAATTAGGAACTGGCCATTACGCGATTGTCAAGGAGGCTAGGAATAAGGAAACTGGT
GAGACCGTCGCGGTAAAGATATTCCATCCTCAACAAAATGACGATGACAAAAGAACAAAA
AAATTCACAGAAGAGACTAAGATCCTTCTATCTATCCAACATCCGAATATAGTTAAACTC
ATAGATAGATTTGTTGAACCGGTCAGCAAAACACAGATTCAAACGTATTTGGTGCTTGAA
AAGATCAATGATGGCGAATTGTTTGAAAGGATTGTTCGAAAAAATAACCTTCGGGAGGAT
GAGACTAAAGCTTTGTTTAGGCAATTACTAAATGGGTTGAAATACTTGCATAGTAGAAAT
ATCATTCACAGAGATATCAAACCTGAAAATATTCTCTTGAGTATAAGTAAAAGACGTTCC
CCAGAAGAAATTGCTTTAGGGCCCTGGGATGACGACGAATTAGATATACAAGTTAAAATA
GCAGATTTTGGGTTGGCGAAATTCACCGGTGAAATGAAGTTTACCAATACACTATGTGGA
ACACCTTCTTACGTTGCTCCTGAAGTTTTAGTCAAAACAGGGTATACATCCAGAGTAGAT
ATGTGGAGTGCTGGCGTTCTTCTATATGTTTGTTTGTGTGGATTTCCACCATTCAGTGAA
CAGCTAGCCCCACCTAGTATGAAAGAGCAGATATTGCAAGGAAAGTTTGCATTTTACTCA
CCGTATTGGGACAATATCGATGATTCTGTCTTACACTTAATTTCTAATCTACTAGTTGTG
AATCCCGCAAGCAGGTTCTCTGTAAATGACGCACTTACGCATCCATGGTTCACCAGCAAT
AACGCTGAAGTCACGATGGGTAATGAAAGAAGATCTCAGTTAGAGCCAGGTAGACTACCA
AAAACCTTCTCTGAATTATCTAATCTTCAAAAATAA

Coding sequence    

>KLLA0E01585g.cds
ATGTCACCTAGTGAAGTATTCTCGTGCAAATATCAGTCATTATCAATGAATCCAGCAGTG
AAGCGAAGGGCTCAACAGGATACCCAAAGTTCAAACAATAATCAGAGAATCATTGCAACA
CTTCTTAGTTTGATACCAGATAGAGAACAGAAAATTCAGTTAGTTGACATTCCGACAATT
TCCGTTGGAAGAAGTCGATCATGTAACATCGTACTTTCAGAGCCAGATATCTCAACCATA
CATGCTGAACTGTACACCATTGAGGTACAAATTAACGGATTCAAGCGTAAAATGATCAAT
ATCACCGATAAAAGCCGTAATGGAACGTTTGTGAACGGTGATAGGCTCATCAGAAAAGAC
TATGTTTTAAAGAATGGTGATAAAATAGTATTCGGGAAAAGCTGTTCATATCTTTTCAAA
TATGCTACACTTACAGAAAATGGACTAAGTCAAACAACAGCCACTCAAATTTCACAAACT
ACGCAAAACAGCGATTATGATGGGGTTTTCAGAAAACCTTTATTCAGTAGTCAAAATACA
ACCAAGAAACTATCAAGAACAAGGGAGCAGCCCAGATCCTTTTTCGACAAATACTTAGCT
GGGAAAGAATTAGGAACTGGCCATTACGCGATTGTCAAGGAGGCTAGGAATAAGGAAACT
GGTGAGACCGTCGCGGTAAAGATATTCCATCCTCAACAAAATGACGATGACAAAAGAACA
AAAAAATTCACAGAAGAGACTAAGATCCTTCTATCTATCCAACATCCGAATATAGTTAAA
CTCATAGATAGATTTGTTGAACCGGTCAGCAAAACACAGATTCAAACGTATTTGGTGCTT
GAAAAGATCAATGATGGCGAATTGTTTGAAAGGATTGTTCGAAAAAATAACCTTCGGGAG
GATGAGACTAAAGCTTTGTTTAGGCAATTACTAAATGGGTTGAAATACTTGCATAGTAGA
AATATCATTCACAGAGATATCAAACCTGAAAATATTCTCTTGAGTATAAGTAAAAGACGT
TCCCCAGAAGAAATTGCTTTAGGGCCCTGGGATGACGACGAATTAGATATACAAGTTAAA
ATAGCAGATTTTGGGTTGGCGAAATTCACCGGTGAAATGAAGTTTACCAATACACTATGT
GGAACACCTTCTTACGTTGCTCCTGAAGTTTTAGTCAAAACAGGGTATACATCCAGAGTA
GATATGTGGAGTGCTGGCGTTCTTCTATATGTTTGTTTGTGTGGATTTCCACCATTCAGT
GAACAGCTAGCCCCACCTAGTATGAAAGAGCAGATATTGCAAGGAAAGTTTGCATTTTAC
TCACCGTATTGGGACAATATCGATGATTCTGTCTTACACTTAATTTCTAATCTACTAGTT
GTGAATCCCGCAAGCAGGTTCTCTGTAAATGACGCACTTACGCATCCATGGTTCACCAGC
AATAACGCTGAAGTCACGATGGGTAATGAAAGAAGATCTCAGTTAGAGCCAGGTAGACTA
CCAAAAACCTTCTCTGAATTATCTAATCTTCAAAAATAA

Predicted translation product    

>KLLA0E01585g.aa
MSPSEVFSCKYQSLSMNPAVKRRAQQDTQSSNNNQRIIATLLSLIPDREQKIQLVDIPTI
SVGRSRSCNIVLSEPDISTIHAELYTIEVQINGFKRKMINITDKSRNGTFVNGDRLIRKD
YVLKNGDKIVFGKSCSYLFKYATLTENGLSQTTATQISQTTQNSDYDGVFRKPLFSSQNT
TKKLSRTREQPRSFFDKYLAGKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRT
KKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLRE
DETKALFRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVK
IADFGLAKFTGEMKFTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFS
EQLAPPSMKEQILQGKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWFTS
NNAEVTMGNERRSQLEPGRLPKTFSELSNLQK*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites