KLLA0C08976g


highly similar to uniprot|P25636 Saccharomyces cerevisiae YCR057C PWP2 part of small (ribosomal) subunit (SSU) processosome (contains U3 snoRNA) Eight WD-repeats with homology with G protein beta subunits flanked by nonhomologous N-terminal and C-terminal extensions regulatory protein

Genomic environment map

Element type: CDS
Element length: 2736 nucleotides,
on sense strand of
Klla0C: 784536..787271.
Other names:
KLLA-ORF7777
Coding sequence: 912 codons.
Database cross references:
EMBL: CR382123
GeneID: 2892246
GenomeReviews: CR382123_GR
HOGENOM: HBG721153

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0129
Orthologs: strict determination not possible; homologs must be refined manually

Protein KLLA0C08976p  


highly similar to uniprot|P25636 Saccharomyces cerevisiae YCR057C PWP2 part of small (ribosomal) subunit (SSU) processosome (contains U3 snoRNA) Eight WD-repeats with homology with G protein beta subunits flanked by nonhomologous N-terminal and C-terminal extensions regulatory protein; SubName: Full=KLLA0C08976p;

Protein domain map

Protein length: 911 amino acids
Protein family: GL3C0129
Database cross references:
Gene3D: G3DSA:2.130.10.10
InterPro: IPR001680
InterPro: IPR007148
InterPro: IPR011046
InterPro: IPR011047
InterPro: IPR015943
InterPro: IPR017986
InterPro: IPR019775
InterPro: IPR019781
InterPro: IPR019782
InterPro: IPR020472
KEGG: kla:KLLA0C08976g
PRINTS: PR00320
PROSITE: PS00678
PROSITE: PS50082
PROSITE: PS50294
Pfam: PF00400
Pfam: PF04003
RefSeq: XP_452599.1
SMART: SM00320
UniProtKB/TrEMBL: Q6CTZ0
UniProtKB: Q6CTZ0_KLULA

Phylogeny  

PhylomeDB:KLLA0C08976g

Computed results for KLLA0C08976p  

None available yet

Gene Ontology terms  

None available yet

Sequence data  


Nucleotide sequence    

>KLLA0C08976g.nt
ATGAAGTCTGATTTTAAGTTTTCCAATCTTTTGGGAACTGTTTATAGGCAAGGTAACGTC
TTGTTCTCTCAAGATGGTTCCAAGTTACTTTCACCGGTAGGTAATAGGGTGTCGGTATTT
GATTTGATCAACAATACTGCTTTTACCTTCGAATATGAACATAGGAAGAACGTTGCCGTT
GTAGATATCAACAAGCAAGGTACGTTACTTCTTTCCATTGATGTCGATGGTCGTGGTATC
TTGGCGAACTTTAAGACAAGAAACGTATTGCATCATTTCAACTTCAAAGAAAAGGTTTAT
GACTTGAAGTTTTCACCTGATGGCAAGTTATTTGCGCTGGCTTGTGGGAGATTCTTACAA
ATATGGAGGACACCCGAGACCACTGAGGATAGACAGTTTGCACCTTTTGTTCGTTATAGA
ATCCATGCCGGCCACTTTTCTGATATAACTTCCTTGACATGGTCAAAAGATTCAAGATTT
ATTATATCCACATCCAAGGACCTAACGGCAAGGATATGGTCAGTTAACTCGGAGGAGAAA
AATCTTGCATCGACGACTTTTGCAGGACATAGAGATAACGTTATCGGAGCATATTTCAGC
GATGACCAGGAAAAGATATACACGGTCAGTAAAGATGGTGCCTTATTCCAATGGGAATAC
ACCAAAAAGCCTGGTGAAGGGGAAGACAATGATGAAGATGAGGAAGATGTAGATTTGTCA
AAATATAGTTGGAGAATCACAAAGAAGAATTTTTTCCATGCAAACAGAGCAAAGGTGAAG
TGTTCTGCATTCCATGCTGCATCCAACATATTAACAGTCGGTTTCTCAAACGGTGAATTC
CGACTCTATGAACTGCCAGAATTCATCATGATTCAACAACTTTCAATGGGTCAAAATGCA
GTTAATACGGTTGCCATCAACAGTTCTGGTGAATGGTTGGCTTTCGGTTCTAGTAAACTT
GGGCAATTGATAGTGTACGAATGGCAATCAGAGTCATATATTCTAAAACAACAAGGTCAT
TTCGATACGTTAAATGGATTGTGTTACTCCCCAGATGGATCGAAGATTGTCACAGCAAGT
CACGAAGGTAAGATCAAGATTTGGGATGTCGCGTCAGGTTTCTGTTTGGCAACTTTTGAT
GAACATGCAGGTGGTGTAAGTGCAGTAGAATTTGCTAAAAAAGGTCAAGTTTTGTTTTCA
GCTTCTTTGGATGGTACCGTGAAAGCATGGGACTTGATCAGATATCGTAATTTCAGAACG
TTCACTGCGACCGAAAGAATACAGTTCAACTCATTAGCAGTTGATCCAAGCGGAGAAGTT
GTATGTGCCGGGTCGGAAGATAGCTTTGACATTTTTGTTTGGTCAGTACAGACTGGTCAG
TTAGTGGATACACTATCTGGCCATGAAGGTCCTATCTCCTGTTTATCTTTCAGTAATGAG
AATGGAGTTTTGGCATCCGCTTCATGGGATAAAACAATTAGAGTGTGGTCTCTCTTCGGT
AGAAGTCAACAGGTAGAGCCTTTTGAAGTATTTTCTGATGTTTTATCTATTTCTATGAAA
CCGGATGGTCAACAAATAGCTGCAAGTACTCTAGCGGGGCAAATATTATTCTTTGATGTT
GCTGAGGGCAAACAGGTGGGAAATATTGACGGCAAAAGGGATATAATCTCGGGTAGACAT
TTGGAAGATCGGTTCACATCAGAAAGTTCAGCAAGATCTAAATATTTTACCACCATTCAT
TACAGTTTCGATGGTCTCTCTTTGGTTGCAGCCGGTAACAATAATTCCATATGTCTTTAT
GACATTCCAAACGAAGTACTGCTAAGAAGATTTACCGTATCCAAAAACATGATGTTAAAC
GGCACCATGGAGTTTTTAAACTCAAGTAGAATGACAGAAGCAGGATCTTTGGATCTCATT
GATCAAGATGCAGAAAATTCAGACTTGGAAGATCGCGTAGATAACAGCCTTCCTGGTTCG
AATAGAGGAGGTGACTTATCGACAAGAAGAGTCAGACCGGCGATCAGAGTGACGTCTATA
AGATTCTCTCCTACTGCTAATGCATTTGCCGCCGGTTCAACAGAAGGTTTACTTGTATAT
TCCGTTGATAATACTATTCTTTTTGATCCTTTCGATCTTGACGTCGATGTGACTCCACAG
AATGTTATCCAAAGCTTAGATGACAAGGAATATCTCAATGCCATACTAATGGCTTTCCGT
CTAAATGAGGGCTATCTAATCCACAGAGTATATGAGAATATTCCAATAAAGGATATTCCA
TTGATAGCTCACGAGTTGCCAGTGGTTTACGTATCAAGAATTCTAAAATTCATTGGTGAG
TACGCTTTAGAATCACAGCATTTGGAGTTCAATCTCCTTTGGATCAAATCTGTACTTACA
GCCCACGGCAAATACATTTCTACTAATAAGCATCAATTCTCTAGCGCATTGAGAGCTGTC
CAAAGATTTATTGGTAGAATGGCAAATGACGTCGTCCAAACATACAAGAGAAATAAGTAC
ACATTAGACTTTTTGACAAATACCGATGGTTCTTCAACTAACGCTGTTGACGAGGATATG
AATCTACTGGGCAATGATTCAGACAACGAATCTGAAGACAAAGAGGATATCAACATGGAC
GACGATTTAGATGGAGGTGAATGGGTTGGATTCGAGGAAAAAACTATTAATCTTCCTGTT
AATGACGAAGATTCTGACGACGAAATCCTACTATGA

Coding sequence    

>KLLA0C08976g.cds
ATGAAGTCTGATTTTAAGTTTTCCAATCTTTTGGGAACTGTTTATAGGCAAGGTAACGTC
TTGTTCTCTCAAGATGGTTCCAAGTTACTTTCACCGGTAGGTAATAGGGTGTCGGTATTT
GATTTGATCAACAATACTGCTTTTACCTTCGAATATGAACATAGGAAGAACGTTGCCGTT
GTAGATATCAACAAGCAAGGTACGTTACTTCTTTCCATTGATGTCGATGGTCGTGGTATC
TTGGCGAACTTTAAGACAAGAAACGTATTGCATCATTTCAACTTCAAAGAAAAGGTTTAT
GACTTGAAGTTTTCACCTGATGGCAAGTTATTTGCGCTGGCTTGTGGGAGATTCTTACAA
ATATGGAGGACACCCGAGACCACTGAGGATAGACAGTTTGCACCTTTTGTTCGTTATAGA
ATCCATGCCGGCCACTTTTCTGATATAACTTCCTTGACATGGTCAAAAGATTCAAGATTT
ATTATATCCACATCCAAGGACCTAACGGCAAGGATATGGTCAGTTAACTCGGAGGAGAAA
AATCTTGCATCGACGACTTTTGCAGGACATAGAGATAACGTTATCGGAGCATATTTCAGC
GATGACCAGGAAAAGATATACACGGTCAGTAAAGATGGTGCCTTATTCCAATGGGAATAC
ACCAAAAAGCCTGGTGAAGGGGAAGACAATGATGAAGATGAGGAAGATGTAGATTTGTCA
AAATATAGTTGGAGAATCACAAAGAAGAATTTTTTCCATGCAAACAGAGCAAAGGTGAAG
TGTTCTGCATTCCATGCTGCATCCAACATATTAACAGTCGGTTTCTCAAACGGTGAATTC
CGACTCTATGAACTGCCAGAATTCATCATGATTCAACAACTTTCAATGGGTCAAAATGCA
GTTAATACGGTTGCCATCAACAGTTCTGGTGAATGGTTGGCTTTCGGTTCTAGTAAACTT
GGGCAATTGATAGTGTACGAATGGCAATCAGAGTCATATATTCTAAAACAACAAGGTCAT
TTCGATACGTTAAATGGATTGTGTTACTCCCCAGATGGATCGAAGATTGTCACAGCAAGT
CACGAAGGTAAGATCAAGATTTGGGATGTCGCGTCAGGTTTCTGTTTGGCAACTTTTGAT
GAACATGCAGGTGGTGTAAGTGCAGTAGAATTTGCTAAAAAAGGTCAAGTTTTGTTTTCA
GCTTCTTTGGATGGTACCGTGAAAGCATGGGACTTGATCAGATATCGTAATTTCAGAACG
TTCACTGCGACCGAAAGAATACAGTTCAACTCATTAGCAGTTGATCCAAGCGGAGAAGTT
GTATGTGCCGGGTCGGAAGATAGCTTTGACATTTTTGTTTGGTCAGTACAGACTGGTCAG
TTAGTGGATACACTATCTGGCCATGAAGGTCCTATCTCCTGTTTATCTTTCAGTAATGAG
AATGGAGTTTTGGCATCCGCTTCATGGGATAAAACAATTAGAGTGTGGTCTCTCTTCGGT
AGAAGTCAACAGGTAGAGCCTTTTGAAGTATTTTCTGATGTTTTATCTATTTCTATGAAA
CCGGATGGTCAACAAATAGCTGCAAGTACTCTAGCGGGGCAAATATTATTCTTTGATGTT
GCTGAGGGCAAACAGGTGGGAAATATTGACGGCAAAAGGGATATAATCTCGGGTAGACAT
TTGGAAGATCGGTTCACATCAGAAAGTTCAGCAAGATCTAAATATTTTACCACCATTCAT
TACAGTTTCGATGGTCTCTCTTTGGTTGCAGCCGGTAACAATAATTCCATATGTCTTTAT
GACATTCCAAACGAAGTACTGCTAAGAAGATTTACCGTATCCAAAAACATGATGTTAAAC
GGCACCATGGAGTTTTTAAACTCAAGTAGAATGACAGAAGCAGGATCTTTGGATCTCATT
GATCAAGATGCAGAAAATTCAGACTTGGAAGATCGCGTAGATAACAGCCTTCCTGGTTCG
AATAGAGGAGGTGACTTATCGACAAGAAGAGTCAGACCGGCGATCAGAGTGACGTCTATA
AGATTCTCTCCTACTGCTAATGCATTTGCCGCCGGTTCAACAGAAGGTTTACTTGTATAT
TCCGTTGATAATACTATTCTTTTTGATCCTTTCGATCTTGACGTCGATGTGACTCCACAG
AATGTTATCCAAAGCTTAGATGACAAGGAATATCTCAATGCCATACTAATGGCTTTCCGT
CTAAATGAGGGCTATCTAATCCACAGAGTATATGAGAATATTCCAATAAAGGATATTCCA
TTGATAGCTCACGAGTTGCCAGTGGTTTACGTATCAAGAATTCTAAAATTCATTGGTGAG
TACGCTTTAGAATCACAGCATTTGGAGTTCAATCTCCTTTGGATCAAATCTGTACTTACA
GCCCACGGCAAATACATTTCTACTAATAAGCATCAATTCTCTAGCGCATTGAGAGCTGTC
CAAAGATTTATTGGTAGAATGGCAAATGACGTCGTCCAAACATACAAGAGAAATAAGTAC
ACATTAGACTTTTTGACAAATACCGATGGTTCTTCAACTAACGCTGTTGACGAGGATATG
AATCTACTGGGCAATGATTCAGACAACGAATCTGAAGACAAAGAGGATATCAACATGGAC
GACGATTTAGATGGAGGTGAATGGGTTGGATTCGAGGAAAAAACTATTAATCTTCCTGTT
AATGACGAAGATTCTGACGACGAAATCCTACTATGA

Predicted translation product    

>KLLA0C08976g.aa
MKSDFKFSNLLGTVYRQGNVLFSQDGSKLLSPVGNRVSVFDLINNTAFTFEYEHRKNVAV
VDINKQGTLLLSIDVDGRGILANFKTRNVLHHFNFKEKVYDLKFSPDGKLFALACGRFLQ
IWRTPETTEDRQFAPFVRYRIHAGHFSDITSLTWSKDSRFIISTSKDLTARIWSVNSEEK
NLASTTFAGHRDNVIGAYFSDDQEKIYTVSKDGALFQWEYTKKPGEGEDNDEDEEDVDLS
KYSWRITKKNFFHANRAKVKCSAFHAASNILTVGFSNGEFRLYELPEFIMIQQLSMGQNA
VNTVAINSSGEWLAFGSSKLGQLIVYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTAS
HEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRT
FTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSFSNE
NGVLASASWDKTIRVWSLFGRSQQVEPFEVFSDVLSISMKPDGQQIAASTLAGQILFFDV
AEGKQVGNIDGKRDIISGRHLEDRFTSESSARSKYFTTIHYSFDGLSLVAAGNNNSICLY
DIPNEVLLRRFTVSKNMMLNGTMEFLNSSRMTEAGSLDLIDQDAENSDLEDRVDNSLPGS
NRGGDLSTRRVRPAIRVTSIRFSPTANAFAAGSTEGLLVYSVDNTILFDPFDLDVDVTPQ
NVIQSLDDKEYLNAILMAFRLNEGYLIHRVYENIPIKDIPLIAHELPVVYVSRILKFIGE
YALESQHLEFNLLWIKSVLTAHGKYISTNKHQFSSALRAVQRFIGRMANDVVQTYKRNKY
TLDFLTNTDGSSTNAVDEDMNLLGNDSDNESEDKEDINMDDDLDGGEWVGFEEKTINLPV
NDEDSDDEILL*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites