DEHA2G10978g


similar to uniprot|P04173 Saccharomyces cerevisiae YCL018W LEU2 Beta-isopropylmalate dehydrogenase

Genomic environment map

Element type: CDS
Element length: 1149 nucleotides,
on sense strand of
Deha2G: 920454..921602.
Other names:
DEHA-CDS3335.1
DEHA-IPF4076
DEHA0G11946g
Coding sequence: 383 codons.
Database cross references:
EMBL: AY683206
EMBL: CR382139
GeneID: 2904925
GenomeReviews: CR382139_GR
HOGENOM: HBG518924

Computed results  

None available yet


Protein DEHA2G10978p  


similar to uniprot|P04173 Saccharomyces cerevisiae YCL018W LEU2 Beta-isopropylmalate dehydrogenase; RecName: Full=3-isopropylmalate dehydrogenase; Short=3-IPM-DH; Short=IMDH; EC=1.1.1.85; AltName: Full=Beta-IPM dehydrogenase;

Protein domain map

Protein length: 382 amino acids
Protein family: GL3C0069
Database cross references:
Gene3D: G3DSA:3.40.718.10
InterPro: IPR001804
InterPro: IPR004429
InterPro: IPR019818
InterPro: IPR024084
KEGG: dha:DEHA2G10978g
PANTHER: PTHR11835
PANTHER: PTHR11835:SF13
PROSITE: PS00470
Pfam: PF00180
RefSeq: XP_462020.1
TIGRFAMs: TIGR00169
UniProtKB/Swiss-Prot: Q6B458
UniProtKB: LEU3_DEBHA

Computed results for DEHA2G10978p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>DEHA2G10978g.nt
ATGTCCCAACCTGAATTAAAAAAATCAAAAGTTGATATAAGCAAAACCATCACAGTTTTA
CCAGGTGATCATGTCGGTGAAGAAGTTTGTAACGAGGCCATCAAAGTCTTACAAGCTATT
GAGGATGCTACCCCATACAGAAACATTAAGTTCAATTTGCAAAAACATTTGATAGGTGGT
GCCGCAATTGACGCTACTGGTACTCCATTACCAGATGAATCTTTGGAGGCTGCAAAAAAT
TCTGATGCTGTCTTATTAGGTGCTGTCGGTGGCCCAAAATGGGGTACCGGTTCCGTTAGA
CCTGAGCAAGGTTTATTAAAAATTAGAAAGGAATTGAACTTATATGCTAACTTGAGACCA
TGTAACTTTGCGTCCGATAGCTTATTAGAATTGTCTCCATTAAAGTCTGAGATTGTGAAG
GGTACTGATTTTACTGTTGTTCGTGAATTAGTTGGTGGTATCTATTTTGGAGAAAGACAA
GAACAAGCAGAATCAGAAGACAAGCAGACTGCATGGGATACTGAAAAGTATTCTACTGAA
GAAGTAACTAGAATTACTAGAATGGCAGCATTTATGGCGTTACAACATAATCCACCATTA
CCAATCTGGTCTTTAGATAAGGCTAATGTTTTGGCGTCTTCAAGATTATGGAGAACAACT
GTTGATAAAGTTATGTCTGAAGAATTTCCACAATTAACAATTCAACATCAATTAATTGAC
TCGGCGGCTATGATTTTGGTTCAATCTCCAACTAAGTTAAATGGTATTATTATCACTTCT
AATATGTTTGGTGATATTATTTCTGATGAAGCATCTGTTATCCCTGGGTCATTGGGGCTC
TTACCTTCTGCTTCTTTGGCTTCGTTGCCAGATACTAATTCCGCTTTTGGTTTGTATGAA
CCATGTCATGGTTCAGCTCCAGATTTGACGGAAAACAAAGTTAATCCTGTCGCTACCATA
TTATCCGTAGCAATGATGTTAAGGTTATCTTTGGATTGTGTACCAGAAGCTGAAGCTTTG
GAAAAGGCAGTCGGTCAAGTCTTAGATTCCGGAATAAGAACAGGAGATTTACGTGGTTCA
AGCTCCACTAAAGAAGTCGGTGATGCGATCGCGGAAGCAGTCAAGAAGGTATTGAATCAA
TCAGTCTAG

Coding sequence    

>DEHA2G10978g.cds
ATGTCCCAACCTGAATTAAAAAAATCAAAAGTTGATATAAGCAAAACCATCACAGTTTTA
CCAGGTGATCATGTCGGTGAAGAAGTTTGTAACGAGGCCATCAAAGTCTTACAAGCTATT
GAGGATGCTACCCCATACAGAAACATTAAGTTCAATTTGCAAAAACATTTGATAGGTGGT
GCCGCAATTGACGCTACTGGTACTCCATTACCAGATGAATCTTTGGAGGCTGCAAAAAAT
TCTGATGCTGTCTTATTAGGTGCTGTCGGTGGCCCAAAATGGGGTACCGGTTCCGTTAGA
CCTGAGCAAGGTTTATTAAAAATTAGAAAGGAATTGAACTTATATGCTAACTTGAGACCA
TGTAACTTTGCGTCCGATAGCTTATTAGAATTGTCTCCATTAAAGTCTGAGATTGTGAAG
GGTACTGATTTTACTGTTGTTCGTGAATTAGTTGGTGGTATCTATTTTGGAGAAAGACAA
GAACAAGCAGAATCAGAAGACAAGCAGACTGCATGGGATACTGAAAAGTATTCTACTGAA
GAAGTAACTAGAATTACTAGAATGGCAGCATTTATGGCGTTACAACATAATCCACCATTA
CCAATCTGGTCTTTAGATAAGGCTAATGTTTTGGCGTCTTCAAGATTATGGAGAACAACT
GTTGATAAAGTTATGTCTGAAGAATTTCCACAATTAACAATTCAACATCAATTAATTGAC
TCGGCGGCTATGATTTTGGTTCAATCTCCAACTAAGTTAAATGGTATTATTATCACTTCT
AATATGTTTGGTGATATTATTTCTGATGAAGCATCTGTTATCCCTGGGTCATTGGGGCTC
TTACCTTCTGCTTCTTTGGCTTCGTTGCCAGATACTAATTCCGCTTTTGGTTTGTATGAA
CCATGTCATGGTTCAGCTCCAGATTTGACGGAAAACAAAGTTAATCCTGTCGCTACCATA
TTATCCGTAGCAATGATGTTAAGGTTATCTTTGGATTGTGTACCAGAAGCTGAAGCTTTG
GAAAAGGCAGTCGGTCAAGTCTTAGATTCCGGAATAAGAACAGGAGATTTACGTGGTTCA
AGCTCCACTAAAGAAGTCGGTGATGCGATCGCGGAAGCAGTCAAGAAGGTATTGAATCAA
TCAGTCTAG

Predicted translation product    

>DEHA2G10978g.aa
MSQPELKKSKVDISKTITVLPGDHVGEEVCNEAIKVLQAIEDATPYRNIKFNLQKHLIGG
AAIDATGTPLPDESLEAAKNSDAVLLGAVGGPKWGTGSVRPEQGLLKIRKELNLYANLRP
CNFASDSLLELSPLKSEIVKGTDFTVVRELVGGIYFGERQEQAESEDKQTAWDTEKYSTE
EVTRITRMAAFMALQHNPPLPIWSLDKANVLASSRLWRTTVDKVMSEEFPQLTIQHQLID
SAAMILVQSPTKLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNSAFGLYE
PCHGSAPDLTENKVNPVATILSVAMMLRLSLDCVPEAEALEKAVGQVLDSGIRTGDLRGS
SSTKEVGDAIAEAVKKVLNQSV*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites