DEHA2F15466g


similar to uniprot|P22219 Saccharomyces cerevisiae YBR097W VPS15 Myristoylated Serine/threonine protein kinase involved in vacuolar protein sorting

Genomic environment map

Element type: CDS
Element length: 4581 nucleotides,
on sense strand of
Deha2F: 1294058..1298638.
Other names:
DEHA-CDS0108.1
DEHA-IPF7791
DEHA0F16742g
Coding sequence: 1527 codons.
Database cross references:
EMBL: CR382138
GeneID: 2904160
GenomeReviews: CR382138_GR
HOGENOM: HBG398564

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3R1653
Orthologs: strict determination not possible; homologs must be refined manually

Protein DEHA2F15466p  


similar to uniprot|P22219 Saccharomyces cerevisiae YBR097W VPS15 Myristoylated Serine/threonine protein kinase involved in vacuolar protein sorting; SubName: Full=DEHA2F15466p;

Protein domain map

Protein length: 1526 amino acids
Protein family: GL3R1653
Database cross references:
Gene3D: G3DSA:1.25.10.10
Gene3D: G3DSA:2.130.10.10
InterPro: IPR000719
InterPro: IPR001680
InterPro: IPR008271
InterPro: IPR011009
InterPro: IPR011046
InterPro: IPR011989
InterPro: IPR015943
InterPro: IPR016024
InterPro: IPR017442
InterPro: IPR017986
InterPro: IPR019781
InterPro: IPR019782
InterPro: IPR021133
KEGG: dha:DEHA2F15466g
PROSITE: PS00108
PROSITE: PS50011
PROSITE: PS50077
PROSITE: PS50082
PROSITE: PS50294
Pfam: PF00069
Pfam: PF00400
RefSeq: XP_461033.2
SMART: SM00320
UniProtKB/TrEMBL: Q6BL88
UniProtKB: Q6BL88_DEBHA

Computed results for DEHA2F15466p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>DEHA2F15466g.nt
ATGGGCGCTAGGTTGTCATTATTGGCACCTTCAGCACCGACAATAGCCATTTCTTCGTAT
GTGGATATTCTAAATAATATTCAATATGTCGAATTATTAAACAATTCACGATTTCTTAAA
ACGATTAAGGCAGTCGATAATGCATCAGGAAACTTGATAGTTATTAAAATACTCATAAAA
CCTTCGAATAATACTTCGAATTACAACATAGATTTACAGCAATTGACTGAATTATTGGCA
AAAGAATCTTCTTTACTATGCGGGTTTAATAACATCCTACCATGGCACAAAATTATAGAG
ACAGACAGGGCAGGCTATTTGATTAGGCAACTGATTAAGACAAATCTATACGATAGGATA
TCACTAAGGCCCTTTTTAGAACCTATTGAAAAAGCTTTTCTTACGTTCCAAATATTGAGA
ATAATCCATGATTTGCATAATAAATTGAATATCCATCATGGTGATTTAAAATTAGAGAAC
TTTTTGATCACATCGTGGAATTGGGTAATGTTGACAGACTTTGCGAACTATACAAAGCCT
ACGTATCTTCCAGAAGATAATCCAAATCAATTTTCTTTCTATTTTGACACATCAGATAGA
AGACTCTGTTATATCGCGCCTGAAAGGTTCTATAACTCAAAGAGCAATGTTAAACCAATT
CAAAATGTTAATGATTTTGGTCAGTTTAATGGGAAAGACCAACTAACAAATGAAATGGAT
TTATTTAGTTTGGGATGCGTTATAGCTGAATTATATTTGGATGGAGAACCTACTTTTACA
CTATCACAAATATTCAAATATATAAAAAATGAGTATATTCCTGATTTATCGACTATTAAT
GATTCAAACATTAGAGAAATAATAACTAACTTGATTCTGCGTGATCCTGGTGATAGACCA
TCCGTTGATACTATACTCAACGACTATAAAGACAAATGTTTTCCAGGTTTTTTTTATGAG
TTTCTTTATGATTTCATGTCTGAGTTAAATAATAATGATTTATTTGTTATCCCAAGCGAT
AATGATAATCTAACTCCTAGCGATTTGAAGCTTGAAAAGATTTACAAAAGTTATGACAAG
ATAGCTGATGCTTTACAATTTAATTATTCCAATGATCGCAATTCTTCCCTTTCTCAAAAC
TCGAAATTCGTACCATTGATGCTCAATTTAAAAGGAATGCCAAAAAACTATACAGTGAAA
CCAACAGTAACCTTTATGGAAAATAATTACCTGCAGCAAGGTTCATTGATTATCCTTAAT
TTAATTTTCTCGTTGATGAAATCATTCAAGCAGCCTTTATCCAAAATAAAAGCGTGTGAA
TTAATAGTTGCATTATCAGAGAGGGTTAACGACGATTGCAAATTAGATCGCTGTTTACCA
TATTTATGTAATCTATTGGACGAATACATGGACAGCTCCTCCATAAATTACCAACCAAAT
AATTTTCAAACCAACTTGTCAGAGAACTTCACATCATCTTCAGAAGTAGCATGCATTGCA
TTGACGTCTATAACCACATTGATTATGTCGTGTTCATATATTAACCCGATTAATGTATTA
ATGTTTTCAGAATATTTATTACCAAAGTTGCACGCTTTGATTAGTATATTTCCAAAGAAC
GAGGACAAAAATTTAATCAAAATAACATTGGCTGCATGTTTACCTTACCTTGCAAATGTA
TCTAAGAAATTCTGGATGATGTCCAAGACTTTTAAGAATGATGTTCTAAAAGATTTGAAC
AGTCGACTTTCGTCAAAACCTCTGTTAGACGATAAAGAAAACGTAAGTGACTCTTACAAT
TCATTCAGCATTCGAAAAGAACAGTTAGATTCTGATTTTGAAAACCTTGCCTCCAAATTA
TTAACAGATGTTAACCCCATGGTTAAAATAAGTTTAGTTAACAATATAATGCCATTATGT
CAATTTTTTGGTGTTGATAAAACTAATGATATAATTTTACCACACTTAATCACATACTTA
AATGATTCAAATTATGAATTAAGACTCGCATTCTTGTCGTCGATTTTGGGAATAGGCCCT
TTCGTTGGAGTTTTGTCATTTGAGCAATACATTTTACCCTTATTGATTCAAACTCTAGGT
GATCTGGAACAATTTGTCATTTTAAAAGTCTTGGAAATATTTTATTGTTTTGTACGAGAT
AGGTTGATTAATCCAAAATCTGAATTCAATGCATTGTCAATCTACAAGGAGTTGTTAACA
AGCTCAATAAAGTTACTTCTTCTTCCAAATGAATGGATTAGACAATCGGTAATCTGCCTA
ATTTTAGCAATTAGTGATAATTTGCTGGATGCTGATAAGTATTGTTTTCTTTACCCTATA
GTAAAGGGGTTCTTGGTATATGATGTGAACACTATAAATTGGAATACCTTGTATCCATCT
ATCACAAAGCCATTATCAAAACAGATATACAATTTAGCAATAACTTGGTCATCAAATGCA
TCGAATAAATCTTTATTCTGGCAAGAGAAGAGTTTTTCAGTATTCAATGATTTGAAAGCA
CCTACAAAGATATTGCCCTATTCGACAAATATGGGGAAATCTGTTTATATTCCTAAATCC
AAAAATGGATTTTCTTTGAATAATACGAACTCAAACATTCCATTATCCCCAGAAGATAAA
CAATGGGTTTTAAAACTAAAATCTGTTGGGTTAAACGATAGGGACTTATGGAAGATATTC
ATTTTACGAGATTATATTTATCATTCCAGCAAATCCAATACTTCACCTACGGCTAAAGAT
GATTTTGAACTTCCAAAAGACATTAACATTACCCCACGTAATGTCTTCTTCGAAGTTTGC
TATAAATCGGAACCTTTTTCATCGGGTTCTAAAACAGCAGAAACGAATTTTGAATCAGTG
CATACTCTTTCAAATTCCAAGAAGGATGAAGATTCCACACGAGGATTAAATTCTCTTATA
TTACCTAATTTTGGTAAGGTAAAAGTTTCATTACAGACTGTTCAAGCAAATGTTTTCGGA
GAATTGGATACTAGTCATGATTCTTCTTTCAATGCTAGTAGTAGCCATCATCATCATCAT
ATCCATTCTACGAATAATTCCAATTCGACTCATAGAGTATTTAGTGTTAATAACCAAAAA
ATTATCACTGCAAATATGAAGCATAGTTATACTGGTTATAACCCATATATGTTGAATTAT
TTGCATAATGTCGAATTTGAACCCACGTTAGAGAGCTTTTCAGAATTTGGTAATATCGTA
AAATCTTCGAAAGCAACTACATCAGATAGTAGTATTTGGAAACCACAAGGCATATGCGTA
GCGCATATTAATACAAATAATAGCGATGGTGACATTTATGGAGTAAACTGCATATCTGTT
GGTCCAACTTCAGAGTTTTTTATAACTGGGTCCGAAGATGGAATATTGAGAGTTTGGGAT
ACTTTAAAGTTAGAAAAGAATATCGCCGTTAAACGTGAAAGTCTTTCTATCAAATTAGAG
TCATCAATTGTTGGTATTAAATTTATTCCAAATAGATTTGTATTTCTGGTAATTACTACT
GATGGAAAATTAAGATTGTTTAGAATTGATGTTTCACGGGGAAAGAACAAAAGAATTACC
AAATATACAAGACTTGCCTTGATTAGACATTATAGTTTGGATGTTACAGAGGATGGCTAT
TTAACAAGTATTGAATATTGTATTTCTCTGAAGCATGCTTGGATTGTTGGTATTACATCT
AATTCCAAAATCATAGGATTTGAAATCATCAAGATGGAAGTTGAATTTAATTTGCAAAAT
CCTGTAATGCTTGGTGTAAATACATCATACATAATTGACCACAAGGCAGCGTGGTTGTTA
GTGGGTACGGATAAGGGTAATTTATGTCTATGGGACTTAAGATTTAGAACGCTAGTCAAC
TCCTGGAAATTGAATACAAACAATAAATCTGATAATCTGTCTGCAATAAAGAAATTGATT
TTGATGCCAAATGATTTTAATCTAGATGTAAAACTGGAAAATACTTCTTACTTTGCAATG
ATTGGTGGTACCAACGAGTCAGATATTTCTCTTTGGGAGATTCCGAGCTTTGAATGCCGT
GAAGCGTTTAGTTCGAGTGCAATTAACCCAAAAGTCAAGTTGTTTTCATTGGATAAAATT
GAAGTTACCAAAGAGCCAGAAATTGATGCCATTGTATCGGACTTAAATATAGATTTTGAT
GCTGATAATAATAAGGATAAGAGTATGACCGCATTACTGTCATTCAGAAGCAATACAAGG
GACTATTTTGCATGTGCAACTTGGGATAGAAGGATTATCCTTTGGAATATTTTTGACACA
GCAGAATCCGTCTCTCTCAATAATATGCATGCAACAACTTTCAATAAGTCTAAGGTTAAT
CTGACACTTCAATTGAATTATGAAAGAGTTAGCTTAGATAAGAGGCTGGATGATCTAACT
ACTTTGAATAATATTGCTAGTCAACAATTTGACTCTGTCAGGATGCATCAAGATGTTATA
ACCGATGTAGGTGTAGTCACTAGACCGTTTGAAATGATTGTTTCTGCAGATAGAAATGGC
TTCATTAACTTATATAAGTAA

Coding sequence    

>DEHA2F15466g.cds
ATGGGCGCTAGGTTGTCATTATTGGCACCTTCAGCACCGACAATAGCCATTTCTTCGTAT
GTGGATATTCTAAATAATATTCAATATGTCGAATTATTAAACAATTCACGATTTCTTAAA
ACGATTAAGGCAGTCGATAATGCATCAGGAAACTTGATAGTTATTAAAATACTCATAAAA
CCTTCGAATAATACTTCGAATTACAACATAGATTTACAGCAATTGACTGAATTATTGGCA
AAAGAATCTTCTTTACTATGCGGGTTTAATAACATCCTACCATGGCACAAAATTATAGAG
ACAGACAGGGCAGGCTATTTGATTAGGCAACTGATTAAGACAAATCTATACGATAGGATA
TCACTAAGGCCCTTTTTAGAACCTATTGAAAAAGCTTTTCTTACGTTCCAAATATTGAGA
ATAATCCATGATTTGCATAATAAATTGAATATCCATCATGGTGATTTAAAATTAGAGAAC
TTTTTGATCACATCGTGGAATTGGGTAATGTTGACAGACTTTGCGAACTATACAAAGCCT
ACGTATCTTCCAGAAGATAATCCAAATCAATTTTCTTTCTATTTTGACACATCAGATAGA
AGACTCTGTTATATCGCGCCTGAAAGGTTCTATAACTCAAAGAGCAATGTTAAACCAATT
CAAAATGTTAATGATTTTGGTCAGTTTAATGGGAAAGACCAACTAACAAATGAAATGGAT
TTATTTAGTTTGGGATGCGTTATAGCTGAATTATATTTGGATGGAGAACCTACTTTTACA
CTATCACAAATATTCAAATATATAAAAAATGAGTATATTCCTGATTTATCGACTATTAAT
GATTCAAACATTAGAGAAATAATAACTAACTTGATTCTGCGTGATCCTGGTGATAGACCA
TCCGTTGATACTATACTCAACGACTATAAAGACAAATGTTTTCCAGGTTTTTTTTATGAG
TTTCTTTATGATTTCATGTCTGAGTTAAATAATAATGATTTATTTGTTATCCCAAGCGAT
AATGATAATCTAACTCCTAGCGATTTGAAGCTTGAAAAGATTTACAAAAGTTATGACAAG
ATAGCTGATGCTTTACAATTTAATTATTCCAATGATCGCAATTCTTCCCTTTCTCAAAAC
TCGAAATTCGTACCATTGATGCTCAATTTAAAAGGAATGCCAAAAAACTATACAGTGAAA
CCAACAGTAACCTTTATGGAAAATAATTACCTGCAGCAAGGTTCATTGATTATCCTTAAT
TTAATTTTCTCGTTGATGAAATCATTCAAGCAGCCTTTATCCAAAATAAAAGCGTGTGAA
TTAATAGTTGCATTATCAGAGAGGGTTAACGACGATTGCAAATTAGATCGCTGTTTACCA
TATTTATGTAATCTATTGGACGAATACATGGACAGCTCCTCCATAAATTACCAACCAAAT
AATTTTCAAACCAACTTGTCAGAGAACTTCACATCATCTTCAGAAGTAGCATGCATTGCA
TTGACGTCTATAACCACATTGATTATGTCGTGTTCATATATTAACCCGATTAATGTATTA
ATGTTTTCAGAATATTTATTACCAAAGTTGCACGCTTTGATTAGTATATTTCCAAAGAAC
GAGGACAAAAATTTAATCAAAATAACATTGGCTGCATGTTTACCTTACCTTGCAAATGTA
TCTAAGAAATTCTGGATGATGTCCAAGACTTTTAAGAATGATGTTCTAAAAGATTTGAAC
AGTCGACTTTCGTCAAAACCTCTGTTAGACGATAAAGAAAACGTAAGTGACTCTTACAAT
TCATTCAGCATTCGAAAAGAACAGTTAGATTCTGATTTTGAAAACCTTGCCTCCAAATTA
TTAACAGATGTTAACCCCATGGTTAAAATAAGTTTAGTTAACAATATAATGCCATTATGT
CAATTTTTTGGTGTTGATAAAACTAATGATATAATTTTACCACACTTAATCACATACTTA
AATGATTCAAATTATGAATTAAGACTCGCATTCTTGTCGTCGATTTTGGGAATAGGCCCT
TTCGTTGGAGTTTTGTCATTTGAGCAATACATTTTACCCTTATTGATTCAAACTCTAGGT
GATCTGGAACAATTTGTCATTTTAAAAGTCTTGGAAATATTTTATTGTTTTGTACGAGAT
AGGTTGATTAATCCAAAATCTGAATTCAATGCATTGTCAATCTACAAGGAGTTGTTAACA
AGCTCAATAAAGTTACTTCTTCTTCCAAATGAATGGATTAGACAATCGGTAATCTGCCTA
ATTTTAGCAATTAGTGATAATTTGCTGGATGCTGATAAGTATTGTTTTCTTTACCCTATA
GTAAAGGGGTTCTTGGTATATGATGTGAACACTATAAATTGGAATACCTTGTATCCATCT
ATCACAAAGCCATTATCAAAACAGATATACAATTTAGCAATAACTTGGTCATCAAATGCA
TCGAATAAATCTTTATTCTGGCAAGAGAAGAGTTTTTCAGTATTCAATGATTTGAAAGCA
CCTACAAAGATATTGCCCTATTCGACAAATATGGGGAAATCTGTTTATATTCCTAAATCC
AAAAATGGATTTTCTTTGAATAATACGAACTCAAACATTCCATTATCCCCAGAAGATAAA
CAATGGGTTTTAAAACTAAAATCTGTTGGGTTAAACGATAGGGACTTATGGAAGATATTC
ATTTTACGAGATTATATTTATCATTCCAGCAAATCCAATACTTCACCTACGGCTAAAGAT
GATTTTGAACTTCCAAAAGACATTAACATTACCCCACGTAATGTCTTCTTCGAAGTTTGC
TATAAATCGGAACCTTTTTCATCGGGTTCTAAAACAGCAGAAACGAATTTTGAATCAGTG
CATACTCTTTCAAATTCCAAGAAGGATGAAGATTCCACACGAGGATTAAATTCTCTTATA
TTACCTAATTTTGGTAAGGTAAAAGTTTCATTACAGACTGTTCAAGCAAATGTTTTCGGA
GAATTGGATACTAGTCATGATTCTTCTTTCAATGCTAGTAGTAGCCATCATCATCATCAT
ATCCATTCTACGAATAATTCCAATTCGACTCATAGAGTATTTAGTGTTAATAACCAAAAA
ATTATCACTGCAAATATGAAGCATAGTTATACTGGTTATAACCCATATATGTTGAATTAT
TTGCATAATGTCGAATTTGAACCCACGTTAGAGAGCTTTTCAGAATTTGGTAATATCGTA
AAATCTTCGAAAGCAACTACATCAGATAGTAGTATTTGGAAACCACAAGGCATATGCGTA
GCGCATATTAATACAAATAATAGCGATGGTGACATTTATGGAGTAAACTGCATATCTGTT
GGTCCAACTTCAGAGTTTTTTATAACTGGGTCCGAAGATGGAATATTGAGAGTTTGGGAT
ACTTTAAAGTTAGAAAAGAATATCGCCGTTAAACGTGAAAGTCTTTCTATCAAATTAGAG
TCATCAATTGTTGGTATTAAATTTATTCCAAATAGATTTGTATTTCTGGTAATTACTACT
GATGGAAAATTAAGATTGTTTAGAATTGATGTTTCACGGGGAAAGAACAAAAGAATTACC
AAATATACAAGACTTGCCTTGATTAGACATTATAGTTTGGATGTTACAGAGGATGGCTAT
TTAACAAGTATTGAATATTGTATTTCTCTGAAGCATGCTTGGATTGTTGGTATTACATCT
AATTCCAAAATCATAGGATTTGAAATCATCAAGATGGAAGTTGAATTTAATTTGCAAAAT
CCTGTAATGCTTGGTGTAAATACATCATACATAATTGACCACAAGGCAGCGTGGTTGTTA
GTGGGTACGGATAAGGGTAATTTATGTCTATGGGACTTAAGATTTAGAACGCTAGTCAAC
TCCTGGAAATTGAATACAAACAATAAATCTGATAATCTGTCTGCAATAAAGAAATTGATT
TTGATGCCAAATGATTTTAATCTAGATGTAAAACTGGAAAATACTTCTTACTTTGCAATG
ATTGGTGGTACCAACGAGTCAGATATTTCTCTTTGGGAGATTCCGAGCTTTGAATGCCGT
GAAGCGTTTAGTTCGAGTGCAATTAACCCAAAAGTCAAGTTGTTTTCATTGGATAAAATT
GAAGTTACCAAAGAGCCAGAAATTGATGCCATTGTATCGGACTTAAATATAGATTTTGAT
GCTGATAATAATAAGGATAAGAGTATGACCGCATTACTGTCATTCAGAAGCAATACAAGG
GACTATTTTGCATGTGCAACTTGGGATAGAAGGATTATCCTTTGGAATATTTTTGACACA
GCAGAATCCGTCTCTCTCAATAATATGCATGCAACAACTTTCAATAAGTCTAAGGTTAAT
CTGACACTTCAATTGAATTATGAAAGAGTTAGCTTAGATAAGAGGCTGGATGATCTAACT
ACTTTGAATAATATTGCTAGTCAACAATTTGACTCTGTCAGGATGCATCAAGATGTTATA
ACCGATGTAGGTGTAGTCACTAGACCGTTTGAAATGATTGTTTCTGCAGATAGAAATGGC
TTCATTAACTTATATAAGTAA

Predicted translation product    

>DEHA2F15466g.aa
MGARLSLLAPSAPTIAISSYVDILNNIQYVELLNNSRFLKTIKAVDNASGNLIVIKILIK
PSNNTSNYNIDLQQLTELLAKESSLLCGFNNILPWHKIIETDRAGYLIRQLIKTNLYDRI
SLRPFLEPIEKAFLTFQILRIIHDLHNKLNIHHGDLKLENFLITSWNWVMLTDFANYTKP
TYLPEDNPNQFSFYFDTSDRRLCYIAPERFYNSKSNVKPIQNVNDFGQFNGKDQLTNEMD
LFSLGCVIAELYLDGEPTFTLSQIFKYIKNEYIPDLSTINDSNIREIITNLILRDPGDRP
SVDTILNDYKDKCFPGFFYEFLYDFMSELNNNDLFVIPSDNDNLTPSDLKLEKIYKSYDK
IADALQFNYSNDRNSSLSQNSKFVPLMLNLKGMPKNYTVKPTVTFMENNYLQQGSLIILN
LIFSLMKSFKQPLSKIKACELIVALSERVNDDCKLDRCLPYLCNLLDEYMDSSSINYQPN
NFQTNLSENFTSSSEVACIALTSITTLIMSCSYINPINVLMFSEYLLPKLHALISIFPKN
EDKNLIKITLAACLPYLANVSKKFWMMSKTFKNDVLKDLNSRLSSKPLLDDKENVSDSYN
SFSIRKEQLDSDFENLASKLLTDVNPMVKISLVNNIMPLCQFFGVDKTNDIILPHLITYL
NDSNYELRLAFLSSILGIGPFVGVLSFEQYILPLLIQTLGDLEQFVILKVLEIFYCFVRD
RLINPKSEFNALSIYKELLTSSIKLLLLPNEWIRQSVICLILAISDNLLDADKYCFLYPI
VKGFLVYDVNTINWNTLYPSITKPLSKQIYNLAITWSSNASNKSLFWQEKSFSVFNDLKA
PTKILPYSTNMGKSVYIPKSKNGFSLNNTNSNIPLSPEDKQWVLKLKSVGLNDRDLWKIF
ILRDYIYHSSKSNTSPTAKDDFELPKDINITPRNVFFEVCYKSEPFSSGSKTAETNFESV
HTLSNSKKDEDSTRGLNSLILPNFGKVKVSLQTVQANVFGELDTSHDSSFNASSSHHHHH
IHSTNNSNSTHRVFSVNNQKIITANMKHSYTGYNPYMLNYLHNVEFEPTLESFSEFGNIV
KSSKATTSDSSIWKPQGICVAHINTNNSDGDIYGVNCISVGPTSEFFITGSEDGILRVWD
TLKLEKNIAVKRESLSIKLESSIVGIKFIPNRFVFLVITTDGKLRLFRIDVSRGKNKRIT
KYTRLALIRHYSLDVTEDGYLTSIEYCISLKHAWIVGITSNSKIIGFEIIKMEVEFNLQN
PVMLGVNTSYIIDHKAAWLLVGTDKGNLCLWDLRFRTLVNSWKLNTNNKSDNLSAIKKLI
LMPNDFNLDVKLENTSYFAMIGGTNESDISLWEIPSFECREAFSSSAINPKVKLFSLDKI
EVTKEPEIDAIVSDLNIDFDADNNKDKSMTALLSFRSNTRDYFACATWDRRIILWNIFDT
AESVSLNNMHATTFNKSKVNLTLQLNYERVSLDKRLDDLTTLNNIASQQFDSVRMHQDVI
TDVGVVTRPFEMIVSADRNGFINLYK*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites