DEHA2F09548g


some similarities with uniprot|P38691 Saccharomyces cerevisiae YHR082C KSP1 Nonessential putative serine/threonine protein kinase of unknown cellular role

Genomic environment map

Element type: CDS
Element length: 1428 nucleotides,
on sense strand of
Deha2F: 820967..822394.
Other names:
DEHA-CDS2518.1
DEHA-IPF8306
DEHA0F10461g
Coding sequence: 476 codons.
Database cross references:
EMBL: CR382138
GeneID: 2903618
GenomeReviews: CR382138_GR
HOGENOM: HBG448409

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0493
Orthologs: strict determination not possible; homologs must be refined manually

Protein DEHA2F09548p  


some similarities with uniprot|P38691 Saccharomyces cerevisiae YHR082C KSP1 Nonessential putative serine/threonine protein kinase of unknown cellular role; SubName: Full=DEHA2F09548p;

Protein domain map

Protein length: 475 amino acids
Protein family: GL3C0493
Database cross references:
InterPro: IPR000719
InterPro: IPR008271
InterPro: IPR011009
InterPro: IPR017442
KEGG: dha:DEHA2F09548g
PROSITE: PS00108
PROSITE: PS50011
Pfam: PF00069
RefSeq: XP_460776.2
UniProtKB/TrEMBL: Q6BLZ5
UniProtKB: Q6BLZ5_DEBHA

Computed results for DEHA2F09548p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>DEHA2F09548g.nt
ATGACGATGACTAATACAGCTACTATTAGTGCAAATAGTACTGCTTCCGTTAGAGGCAAC
GAGGCCTTCAACGAGTACGGTGCATACGAGAAGAAACAGTACTTGTTGAAGGACAAATAC
AAGTTCATTACGCCAATTCAAGAGGGAGCCTTCGGGAAGGTTACATTGGCGGTTAATGTC
CAAACGAAGGAGAAGGTGGCCATGAAGGCCATGTATAAATCTCACGAGAATACGAGGAGA
ATCGCGAACCATGAGATCGACGTGTTGAGTAAGATTGGTCGCAACAATGACAATATTTGT
CAATTGCTCGACCACTTTGAGACTTCGGAATTCATCATCTTGATCTTGGAGTATTGTTCC
AATGGTGACTTGTATGATTTGATCCACTCTTCGATCAATATTTCGGCAGTAGATATTTGG
AATATCGCCAAAGAATTGGCCAATGCATTGAAATATGCTCATTCGTTGGGAATTTATCAT
CGCGATATCAAACCCGAGAATGTTTTGTTCAACTGCTTTGGAAGAGTCAAGTTATGTGAT
TGGGGCTTGGCTACTACAAAGAGAATGAACAGAGAGTTCAGCGTCGGTACCGAGAAGTAC
ATGGCACCTGAAGTGTTCATCGAGAAGCCGGAATTGACGGAGTACGATTGTAAGTACGTT
GATTACTGGTCTTTTGGTATTACTTTAATTACAGCAATTTTTGGTACTTGTCCTTTCAAA
CCTGTCGGAGAGTCGTCTAACATTCACTCCGACTATAACTTTAAGAAGTTTGTTTACTAT
GGCAATTCCCAAATCTTATATGATATCTATCCTACAATGAATGAAACCTGCTTCAATATT
TTTATGAACTTATTGAGGATTGGAGGTAATGAAGATAATTTATTAGAATTTAACGATAAG
ATTAATTCGAGGAACTTAGACAATTTTATTCAGGATTTACAAGATAATTGGAAGTTTGGT
TTGACTATTGATGAAGAGTATGAATTGGAACAATTCGATGATGACGCCGAGTCGGATAAT
TCTAATGACCTCTTCAACATGGATCACGATGATTTATCAAGCGAAAGCCAAGACGAACAA
TTATCATTTGATACAAGTGTCGAATCAGAGTCTGATTCGGACGAATACTTAACCAATTAC
GACACTTCAATGAAGATTAGAATGAATCAGGAATCTGATCATCACAATGTTATTCCTTCT
TTAATCGAGTCATCGATTCAATCGCTGTCTTCGAAATCTTGGTGTGACTTGGATGATGAC
GAAGAGTTCAACCAAATCTTCAATGCCATGTCGCTCAACAGAACTAAGAAACCTCAATTA
GATATCGTCAAAGATGACTTCACGAAGTCTAACCTTGGTAATGATGACATTGACATTTTG
AAAGTCGAATGGAATTTATATAATAACAACCACCAGGCGTATAATTGA

Coding sequence    

>DEHA2F09548g.cds
ATGACGATGACTAATACAGCTACTATTAGTGCAAATAGTACTGCTTCCGTTAGAGGCAAC
GAGGCCTTCAACGAGTACGGTGCATACGAGAAGAAACAGTACTTGTTGAAGGACAAATAC
AAGTTCATTACGCCAATTCAAGAGGGAGCCTTCGGGAAGGTTACATTGGCGGTTAATGTC
CAAACGAAGGAGAAGGTGGCCATGAAGGCCATGTATAAATCTCACGAGAATACGAGGAGA
ATCGCGAACCATGAGATCGACGTGTTGAGTAAGATTGGTCGCAACAATGACAATATTTGT
CAATTGCTCGACCACTTTGAGACTTCGGAATTCATCATCTTGATCTTGGAGTATTGTTCC
AATGGTGACTTGTATGATTTGATCCACTCTTCGATCAATATTTCGGCAGTAGATATTTGG
AATATCGCCAAAGAATTGGCCAATGCATTGAAATATGCTCATTCGTTGGGAATTTATCAT
CGCGATATCAAACCCGAGAATGTTTTGTTCAACTGCTTTGGAAGAGTCAAGTTATGTGAT
TGGGGCTTGGCTACTACAAAGAGAATGAACAGAGAGTTCAGCGTCGGTACCGAGAAGTAC
ATGGCACCTGAAGTGTTCATCGAGAAGCCGGAATTGACGGAGTACGATTGTAAGTACGTT
GATTACTGGTCTTTTGGTATTACTTTAATTACAGCAATTTTTGGTACTTGTCCTTTCAAA
CCTGTCGGAGAGTCGTCTAACATTCACTCCGACTATAACTTTAAGAAGTTTGTTTACTAT
GGCAATTCCCAAATCTTATATGATATCTATCCTACAATGAATGAAACCTGCTTCAATATT
TTTATGAACTTATTGAGGATTGGAGGTAATGAAGATAATTTATTAGAATTTAACGATAAG
ATTAATTCGAGGAACTTAGACAATTTTATTCAGGATTTACAAGATAATTGGAAGTTTGGT
TTGACTATTGATGAAGAGTATGAATTGGAACAATTCGATGATGACGCCGAGTCGGATAAT
TCTAATGACCTCTTCAACATGGATCACGATGATTTATCAAGCGAAAGCCAAGACGAACAA
TTATCATTTGATACAAGTGTCGAATCAGAGTCTGATTCGGACGAATACTTAACCAATTAC
GACACTTCAATGAAGATTAGAATGAATCAGGAATCTGATCATCACAATGTTATTCCTTCT
TTAATCGAGTCATCGATTCAATCGCTGTCTTCGAAATCTTGGTGTGACTTGGATGATGAC
GAAGAGTTCAACCAAATCTTCAATGCCATGTCGCTCAACAGAACTAAGAAACCTCAATTA
GATATCGTCAAAGATGACTTCACGAAGTCTAACCTTGGTAATGATGACATTGACATTTTG
AAAGTCGAATGGAATTTATATAATAACAACCACCAGGCGTATAATTGA

Predicted translation product    

>DEHA2F09548g.aa
MTMTNTATISANSTASVRGNEAFNEYGAYEKKQYLLKDKYKFITPIQEGAFGKVTLAVNV
QTKEKVAMKAMYKSHENTRRIANHEIDVLSKIGRNNDNICQLLDHFETSEFIILILEYCS
NGDLYDLIHSSINISAVDIWNIAKELANALKYAHSLGIYHRDIKPENVLFNCFGRVKLCD
WGLATTKRMNREFSVGTEKYMAPEVFIEKPELTEYDCKYVDYWSFGITLITAIFGTCPFK
PVGESSNIHSDYNFKKFVYYGNSQILYDIYPTMNETCFNIFMNLLRIGGNEDNLLEFNDK
INSRNLDNFIQDLQDNWKFGLTIDEEYELEQFDDDAESDNSNDLFNMDHDDLSSESQDEQ
LSFDTSVESESDSDEYLTNYDTSMKIRMNQESDHHNVIPSLIESSIQSLSSKSWCDLDDD
EEFNQIFNAMSLNRTKKPQLDIVKDDFTKSNLGNDDIDILKVEWNLYNNNHQAYN*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites