DEHA2F02244g


similar to uniprot|P00927 Saccharomyces cerevisiae YER086W ILV1 Threonine deaminase catalyzes the first step in isoleucine biosynthesis

Genomic environment map

Element type: CDS
Element length: 1719 nucleotides,
on anti-sense strand of
Deha2F: complement(191719..193437).
Other names:
DEHA-CDS2127.1
DEHA-IPF8928
DEHA0F02530g
Coding sequence: 573 codons.
Database cross references:
EMBL: CR382138
GeneID: 2903966
GenomeReviews: CR382138_GR
HOGENOM: HBG714501

Computed results  

None available yet


Homologs and Orthologs

Homologs in protein family: GL3C0161
Orthologs: strict determination not possible; homologs must be refined manually

Protein DEHA2F02244p  


similar to uniprot|P00927 Saccharomyces cerevisiae YER086W ILV1 Threonine deaminase catalyzes the first step in isoleucine biosynthesis; SubName: Full=DEHA2F02244p;

Protein domain map

Protein length: 572 amino acids
Protein family: GL3C0161
Database cross references:
InterPro: IPR000634
InterPro: IPR001721
InterPro: IPR001926
InterPro: IPR005787
KEGG: dha:DEHA2F02244g
PROSITE: PS00165
Pfam: PF00291
Pfam: PF00585
RefSeq: XP_460463.2
TIGRFAMs: TIGR01124
UniProtKB/TrEMBL: Q6BMV7
UniProtKB: Q6BMV7_DEBHA

Computed results for DEHA2F02244p  

None available yet

Gene Ontology terms  


Sequence data  


Nucleotide sequence    

>DEHA2F02244g.nt
ATGATGATTGCCAGAAACCTATTGAAGGGCATACACAAGCCTGTAAACAGAAGGGTTTGT
ATACCAAAAATTGGTTCGTTAACTTCGGCCAAATTCTATTCCACTCAATCTACGGTTCAA
CAATTTCCAGAATTGCAAGAAGCTGATTTTACGCCCGAAGGTGAGCCAGATTATATTAAG
TTGATATTGACATCTCGGGTTTACGATGTCGTCGATGAAGGTGGATCTCCTCTCACTCAT
GCTGTTAACTTATCACAGAAATGCAATACCAATATATTCTTAAAGCGTGAAGATTTATTA
CCGGTATTTTCATTCAAGTTACGTGGAGCATATAATATGATTGCACATTTACATTCTAAT
TCAAAGTCACCAGTATCAGGGGTAATTGCATGTTCTGCTGGTAATCATGCACAAGGTGTT
GCTTTCTCTGCTAGTAAATTAAAGATTCAATCTACTATAGTCATGCCAACAGCTACTCCT
TCTATCAAATATAAAAATGTTTCTAGATTAGGATCACAAGTTGTTTTATACGGAGACGAT
TTTGATAGCGCGAAGAAAGAATGTGATCGGTTGAGTTCATTGAACGGATTGACCAATATC
CCTCCTTTTAACCACCCATATGTCATCGCAGGTCAAGGTACTATAGCCCTAGAAATCACC
AGACAATTGAGGTTAGACAAACTTGATGCCTTATTTGTTCCAGTAGGTGGAGGTGGATTG
ATAGCTGGGATTGCTGTTTATTTAAAAAAGATTGCTCCCCATGTCAAGATTATTGGTGTC
GAGACTTTTGATGCAGATGCATTGTATCAGTCATTGCAAAACCATCAACTGAAGACATTG
GATCAGGTTGGAGTTTTTGCTGACGGTACTGCTGTCAAGGTTCTTGGTGATGAAACTTGG
AAGCTTTGCCATAAATATGTTGATGAAGTAGTTAGGGTTCTGACCGATGAATTATGTGCA
GCAATTAAAGATATTTTTGAAGATACCAGACTGATTGTTGAACCATCTGGAGCGTTATCT
GTTGCTGGGTTGAAGAGATATCTTAGTGATAATTCTGAAATTGATCATAGGAATAAGAAT
TACGTTCCAATTTTAAGTGGAGCCAATATGAATTTCGATAGATTAAGATTTGTAAGTGAA
AGAGCTGTACTCGGTGAAGGTAAGGAAGTATCATTAGCTGTCACCATTCCTGAGAGACCT
GGTGAGTTTGCTATATTACAGAATATAATCGACCCAAGAGCTATTACAGAATTTTCCTAT
AGATTTAACAATAGTGGTCCTGCAAATATTTTTGTTAGTTTCAATGTTACCAATAAGGAC
AAAGAATTAGCTCCTATTGTTGAATCTATGAAGAGTAATGATTATGAAGTTATTGATATC
TCAGAGAATGAGTTGGCGAAGACTCATGGTCGTTATTTAGTCGGCGGAAAATCTACAACG
GCTAACTGCAATAAGATTTCTAAAGAAAGGTTATTCAGATTCGAATTTCCTGAAAGACCA
GGTGCTTTAACAAAATTTTTACAAACCTTGAAGTATGATTGGGATATAACCTTGTTTCAC
TATAGAAATCATGGCCATGATGTTGGGAAGATTTTGTGTGGTTTTGTACTTCCAGAAGGC
ACAAGCGATGAGGACTTCCAGGATTTCTTGAAAAAAATTGGTTATAATTTTGTTGATGAA
ACAGACAATGTCGTATATAAAAAATTCTTACAAAGCTAG

Coding sequence    

>DEHA2F02244g.cds
ATGATGATTGCCAGAAACCTATTGAAGGGCATACACAAGCCTGTAAACAGAAGGGTTTGT
ATACCAAAAATTGGTTCGTTAACTTCGGCCAAATTCTATTCCACTCAATCTACGGTTCAA
CAATTTCCAGAATTGCAAGAAGCTGATTTTACGCCCGAAGGTGAGCCAGATTATATTAAG
TTGATATTGACATCTCGGGTTTACGATGTCGTCGATGAAGGTGGATCTCCTCTCACTCAT
GCTGTTAACTTATCACAGAAATGCAATACCAATATATTCTTAAAGCGTGAAGATTTATTA
CCGGTATTTTCATTCAAGTTACGTGGAGCATATAATATGATTGCACATTTACATTCTAAT
TCAAAGTCACCAGTATCAGGGGTAATTGCATGTTCTGCTGGTAATCATGCACAAGGTGTT
GCTTTCTCTGCTAGTAAATTAAAGATTCAATCTACTATAGTCATGCCAACAGCTACTCCT
TCTATCAAATATAAAAATGTTTCTAGATTAGGATCACAAGTTGTTTTATACGGAGACGAT
TTTGATAGCGCGAAGAAAGAATGTGATCGGTTGAGTTCATTGAACGGATTGACCAATATC
CCTCCTTTTAACCACCCATATGTCATCGCAGGTCAAGGTACTATAGCCCTAGAAATCACC
AGACAATTGAGGTTAGACAAACTTGATGCCTTATTTGTTCCAGTAGGTGGAGGTGGATTG
ATAGCTGGGATTGCTGTTTATTTAAAAAAGATTGCTCCCCATGTCAAGATTATTGGTGTC
GAGACTTTTGATGCAGATGCATTGTATCAGTCATTGCAAAACCATCAACTGAAGACATTG
GATCAGGTTGGAGTTTTTGCTGACGGTACTGCTGTCAAGGTTCTTGGTGATGAAACTTGG
AAGCTTTGCCATAAATATGTTGATGAAGTAGTTAGGGTTCTGACCGATGAATTATGTGCA
GCAATTAAAGATATTTTTGAAGATACCAGACTGATTGTTGAACCATCTGGAGCGTTATCT
GTTGCTGGGTTGAAGAGATATCTTAGTGATAATTCTGAAATTGATCATAGGAATAAGAAT
TACGTTCCAATTTTAAGTGGAGCCAATATGAATTTCGATAGATTAAGATTTGTAAGTGAA
AGAGCTGTACTCGGTGAAGGTAAGGAAGTATCATTAGCTGTCACCATTCCTGAGAGACCT
GGTGAGTTTGCTATATTACAGAATATAATCGACCCAAGAGCTATTACAGAATTTTCCTAT
AGATTTAACAATAGTGGTCCTGCAAATATTTTTGTTAGTTTCAATGTTACCAATAAGGAC
AAAGAATTAGCTCCTATTGTTGAATCTATGAAGAGTAATGATTATGAAGTTATTGATATC
TCAGAGAATGAGTTGGCGAAGACTCATGGTCGTTATTTAGTCGGCGGAAAATCTACAACG
GCTAACTGCAATAAGATTTCTAAAGAAAGGTTATTCAGATTCGAATTTCCTGAAAGACCA
GGTGCTTTAACAAAATTTTTACAAACCTTGAAGTATGATTGGGATATAACCTTGTTTCAC
TATAGAAATCATGGCCATGATGTTGGGAAGATTTTGTGTGGTTTTGTACTTCCAGAAGGC
ACAAGCGATGAGGACTTCCAGGATTTCTTGAAAAAAATTGGTTATAATTTTGTTGATGAA
ACAGACAATGTCGTATATAAAAAATTCTTACAAAGCTAG

Predicted translation product    

>DEHA2F02244g.aa
MMIARNLLKGIHKPVNRRVCIPKIGSLTSAKFYSTQSTVQQFPELQEADFTPEGEPDYIK
LILTSRVYDVVDEGGSPLTHAVNLSQKCNTNIFLKREDLLPVFSFKLRGAYNMIAHLHSN
SKSPVSGVIACSAGNHAQGVAFSASKLKIQSTIVMPTATPSIKYKNVSRLGSQVVLYGDD
FDSAKKECDRLSSLNGLTNIPPFNHPYVIAGQGTIALEITRQLRLDKLDALFVPVGGGGL
IAGIAVYLKKIAPHVKIIGVETFDADALYQSLQNHQLKTLDQVGVFADGTAVKVLGDETW
KLCHKYVDEVVRVLTDELCAAIKDIFEDTRLIVEPSGALSVAGLKRYLSDNSEIDHRNKN
YVPILSGANMNFDRLRFVSERAVLGEGKEVSLAVTIPERPGEFAILQNIIDPRAITEFSY
RFNNSGPANIFVSFNVTNKDKELAPIVESMKSNDYEVIDISENELAKTHGRYLVGGKSTT
ANCNKISKERLFRFEFPERPGALTKFLQTLKYDWDITLFHYRNHGHDVGKILCGFVLPEG
TSDEDFQDFLKKIGYNFVDETDNVVYKKFLQS*




Legend and notes  


Lengths
The length, in codons, of coding sequences includes the stop codon, hence it is one unit longer than the protein length.

Genomic environment map
Click on the symbol of an element or a family to go to its corresponding page. Colors in the lane "protein encoding genes" indicate strandedness: shades of blue for direct orientation, shades of red for reverse orientation. Colors in the lane "protein family" are arbitrarly chosen in such a way that different protein families have different colors in the map.

Protein domain map
Domains are extracted from SwissProt files. Click on the symbol of a domain to extract the domain sequence.

Genemark image and list
Genemark computation of protein-coding potential of DNA was made from 1000 nucleotides upstream the open reading frame to 300 nucleotides downstream. Thus the open reading frame protein-coding potential appears on frame #3.

Sequences
ColorNucleotide sequence and Coding sequencePredicted translation product
REDstart and stop codonsInitial methionine and sequence end
BLUEcoding sequenceprotein sequence
greynon-coding sequence (upstream, downstream or intron)
greydonor and acceptor splicing sites